Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii F box and leucine-rich-repeat gene


LOCUS       XM_017156695            2805 bp    mRNA    linear   INV 09-DEC-2024
            4 (Fbxl4), mRNA.
ACCESSION   XM_017156695
VERSION     XM_017156695.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156695.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2805
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2805
                     /gene="Fbxl4"
                     /note="F box and leucine-rich-repeat gene 4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108067591"
     CDS             562..2625
                     /gene="Fbxl4"
                     /codon_start=1
                     /product="F-box/LRR-repeat protein 4"
                     /protein_id="XP_017012184.2"
                     /db_xref="GeneID:108067591"
                     /translation="MSLLLPRGGQEPGTESSDTDSPAEAEADALVDFTAMLQRQQSHQ
                     QQRAYGGGGWFGCGNKMQSEQSEDQGYYLEQYVLGVLDFSSQYGIDYSISYTAANVIG
                     RPTKFPAYGDYPETFPMRTYGDWWQRAPSATREIQPQNLPKLTTHDYVVVYFEEFVVP
                     TEVAIFETFNPGAVVRIWAYGLTKHWTCLWEATESDLARPALDSRRFAPALKKTTMIT
                     KTLRIDFNHSQLNYYTEIDAIMLCGRTVSKTHNLLVKQQRTQQLQRQVLVSPPPEAPD
                     PHSQRPKADGSGGPISYKLRTLKFQPNCDEDGATKLHEFINNDLSQFLAENRVEGGGV
                     ETPIVPRICLTDLPFEILLRILSYLDLKSLFRVGQVSRTFYDISTHPLLYAELSLKPY
                     WHVASSELLCTLARRATMLRKLDLSWCGGLGNVSPTEFKKFLTQRGDNLTHLRLNSCK
                     FLNASCIENVGIVCDNLIELSLRNCATDPPLLNFSCLANLKNLERLDLFQTAFETELL
                     LSMLEGNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHFLSARGLQSLA
                     QLHQLEELDLGWCLREASLGDGLFQLLTNCPKLKKLFLSAVRGTTERDLMHIAALGKN
                     LEQLDLMGILNITHERVYDILVHCPKLQLLDLSFCDNIMDRDYDLLADWSRQFSVDIK
                     SSRHH"
     misc_feature    1588..>2532
                     /gene="Fbxl4"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:443914"
     misc_feature    1591..1725
                     /gene="Fbxl4"
                     /note="Region: F-box-like; pfam12937"
                     /db_xref="CDD:463757"
     misc_feature    1636..1710
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    1711..1791
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    1792..1881
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    1882..1941
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    1960..2037
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    2038..2112
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    2113..2196
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    2197..2271
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    2272..2355
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    2356..2433
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    2434..2511
                     /gene="Fbxl4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     polyA_site      2805
                     /gene="Fbxl4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aatcaacact accaccaaaa caaaaacaaa aacaacaaca acggccaaca acaagccaag
       61 ccaaaattaa atttcctttt gttttgctga agaaatagct gaattaacga gaatccccga
      121 gggaattacc accgcttccg ttcccaccac attaggcaga ggtcagaggt cggcggtcgg
      181 cggacagcgg gcaaaggcga ggcgcggata aagctggaac ccaaagagga gtccgcgaac
      241 gcagagtggc cattaattgg attagcaagc gaaaccagag gaaaagcgaa gcgaaaaccc
      301 gggagcattc gccattgagg tctggcccag caacgtgacc gcaaccagga ggtcctagtc
      361 caaggcgaac ccaagggagg caggccggga atacccagag atcggaatca gcgccgtcgt
      421 ccgtggaacc agcgactctg gcgactcggt tatgcccatc gcctgccctg gtacgccggc
      481 ggggaacagt cgccaagctt ggcgtccatc gacacactga ggctcaccca cggccaacgt
      541 ccacggcagc tggcgctggc catgtccctg ctgctgcccc gaggcggcca ggaaccggga
      601 accgagtcca gcgacacgga cagccccgcg gaggcggagg cggacgccct cgtcgacttc
      661 acggcgatgc tgcagcgcca gcagagccac cagcagcagc gggcgtacgg cggcggcggt
      721 tggttcggct gcggcaacaa gatgcagtcg gaacaatcag aggatcaggg ctactacctg
      781 gagcagtatg tccttggcgt gctcgacttc agctcacagt atgggatcga ctatagcatc
      841 tcgtatacgg cggccaatgt gattggcagg ccaacgaaat tccccgccta cggcgactat
      901 ccggagacct ttcccatgcg cacctacggc gactggtggc agcgggctcc gtcggccacg
      961 cgcgagattc agccccagaa tctgccaaag ctgaccacac acgactatgt tgttgtttac
     1021 ttcgaggagt ttgtggtgcc gacggaggtg gccatctttg agaccttcaa tccgggcgcc
     1081 gtggttcgca tctgggccta tggcctcacc aaacactgga catgtttgtg ggaggccacg
     1141 gagagcgatc ttgcacggcc ggcactggac tcgcgtcgct ttgctccggc tctaaagaag
     1201 accacgatga taacgaagac cttgcgcatc gactttaatc acagccaact caactattat
     1261 acggagatcg atgccatcat gctgtgcggt cggactgtgt ccaaaacgca taatctgctg
     1321 gtcaagcagc agcggacgca gcagctgcag aggcaggtgc tcgtatcgcc gccaccagag
     1381 gcgcctgatc ctcattctca gcgaccaaaa gccgatggca gtggcggacc cattagctac
     1441 aagctgcgca cgcttaagtt ccagccgaat tgcgacgaag atggggccac caagctgcat
     1501 gagtttatca acaacgatct gagccagttt ctggccgaaa atcgagtgga gggcggcggc
     1561 gtggaaacgc cgattgtgcc aagaatctgc ctcacggatc tgcccttcga aatcctactg
     1621 cgcatactca gctacctgga cctcaagtct ttgttccgtg tgggccaggt gtcgcgcacc
     1681 ttctacgaca tctccacgca tccgctgctc tacgccgagc tcagcttgaa gccctactgg
     1741 catgtggcca gctccgagct gctgtgcacc ctggcccgca gggccaccat gctgcgcaag
     1801 ctggatctct cctggtgcgg cggcctgggc aacgtctcgc ccaccgagtt caagaaattc
     1861 ctaacccaac gcggcgataa tctaacccac ctgcggctga actcttgcaa attcctcaat
     1921 gccagctgca ttgagaatgt gggcatagtc tgtgataacc tgatagagtt gagtctgcgc
     1981 aactgcgcca ccgatccgcc gctgctgaat ttctcctgtc tggccaatct gaagaatctg
     2041 gagcgactcg atctcttcca aacggccttt gaaacggaac tgctgctcag catgctagag
     2101 ggcaatcgca agcttaagca cctgaatctt gcattttgcg gtgtatcggt gaacatggac
     2161 aatgtggccg cccatctggc cacctacaac acgcagctta tctcgctgga cctgtggaag
     2221 gctcactttt tgtcggccag aggacttcag tcgctggcgc aactgcatca gttggaggag
     2281 ctcgatttgg gctggtgcct aagggaggct tcgctcggcg acggcctgtt ccagctgcta
     2341 accaactgcc ccaagctgaa gaagctattc ctgtcggcgg tgcgcggaac caccgaacgc
     2401 gatctcatgc atattgccgc cctcggcaag aatctggagc aactagacct catgggcatt
     2461 ctgaacataa cgcacgagcg tgtttatgac attctggttc actgtccaaa gcttcaattg
     2521 ctcgacctga gcttctgcga taacataatg gatcgggatt acgatttgct ggcggattgg
     2581 tcgcgtcagt tcagcgtgga catcaagagc agtcggcacc actaggccga accgaagagg
     2641 agtagctatt atccctggta ccatgataag tgtacttcta aatcctatat gtgtcactct
     2701 ctctctgttt atagtaaaat gttatctata tacctactgt tataaatatg aaacatttta
     2761 tattaaactt ggcgattttt taatcactta acttaatgct aaatg