Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii putative glutathione-specific


LOCUS       XM_017156645            1103 bp    mRNA    linear   INV 09-DEC-2024
            gamma-glutamylcyclotransferase 2 (LOC108067565), mRNA.
ACCESSION   XM_017156645
VERSION     XM_017156645.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156645.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1103
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1103
                     /gene="LOC108067565"
                     /note="putative glutathione-specific
                     gamma-glutamylcyclotransferase 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108067565"
     CDS             61..1011
                     /gene="LOC108067565"
                     /codon_start=1
                     /product="putative glutathione-specific
                     gamma-glutamylcyclotransferase 2"
                     /protein_id="XP_017012134.2"
                     /db_xref="GeneID:108067565"
                     /translation="MLGFLQGLRGSGSATEQLPGDIYSEFFADILREARESGCKPGDQ
                     ETPQGFSMLRSFDTENSNQLEPPAATDEDVWIFGYGSLVWKADFPYIDRRRGFVWGFK
                     RRFYQHSIDHRGIPERPGRVVTLLPGDPAEDRVYGVAYRIAASQKGAVLDHLDYREKN
                     GYERCSLEFHEYQNTTAAGGGGDPIQVIMYVATQANDSYAGDVWQVPCIARQIFSSAG
                     PSGPNREYLFNLAAAMEQLFPGAVDEHLEELVACVRRHIDEDEPQLMQHALLREISGI
                     MKEEQLPEQAQLLEKLLERCQQPGGREWLLHGALQPKSEA"
     misc_feature    280..825
                     /gene="LOC108067565"
                     /note="ChaC-like protein; Region: ChaC; pfam04752"
                     /db_xref="CDD:398428"
     misc_feature    order(286..288,295..297,301..306,529..534,544..546,
                     634..636)
                     /gene="LOC108067565"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:119400"
     misc_feature    order(406..411,415..417,544..558,562..564,622..624,
                     631..633)
                     /gene="LOC108067565"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119400"
     misc_feature    532..534
                     /gene="LOC108067565"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:119400"
     polyA_site      1103
                     /gene="LOC108067565"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttagaaatta ataattcttt gtacaattcc ttggcaaaca gagcacgagc accgcggctg
       61 atgttgggct ttctgcaggg actgcgaggc agcggatccg cgacggagca gctgcccggc
      121 gacatataca gcgagttctt cgcggacatc cttcgggagg ccagggaaag cggatgcaag
      181 ccgggcgacc aggaaacacc gcagggattt tccatgctac gcagcttcga tacggagaac
      241 agcaatcaat tggagccgcc ggcggccacg gacgaggatg tgtggatctt tggctacggg
      301 tcgctggtgt ggaaggcgga ctttccctac atagaccggc gacgcggctt tgtttggggc
      361 ttcaagcgcc gcttctacca gcacagcatc gatcaccgcg gaattccaga gcgtcccggc
      421 cgcgtggtca ctctgctgcc gggcgatccc gccgaggatc gcgtctacgg cgtggcttat
      481 cgcattgccg cgagccaaaa gggcgctgtg ctggatcatc tggattaccg ggagaagaat
      541 ggctacgagc ggtgcagctt ggagttccac gagtaccaga ataccaccgc tgctggcggc
      601 ggtggcgatc ccatccaggt gatcatgtac gtggccacgc aggccaacga ctcgtatgcc
      661 ggcgatgttt ggcaagtgcc ctgtatcgcg aggcaaatct tcagctccgc cggtcccagt
      721 ggacccaatc gcgagtacct gttcaacctg gccgccgcca tggagcagct atttcccggt
      781 gccgttgacg agcacctgga ggagctggtg gcctgcgtga ggcgtcacat tgacgaggat
      841 gagccccagc tgatgcagca cgccctgttg cgagagatat ccgggatcat gaaggaggag
      901 cagctgccgg agcaggcaca gcttcttgaa aagcttctgg aacgttgcca gcagcctggc
      961 ggacgtgagt ggctgctcca cggggcactg cagcccaaga gcgaggcgtg acccccacct
     1021 tttccactag aaaattacta tttattataa ataccaatga gcctgggtgg ttttttttct
     1081 aaatacacca ttccaaatag acc