Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii 9,11-endoperoxide prostaglandin H2


LOCUS       XM_017156643             738 bp    mRNA    linear   INV 09-DEC-2024
            reductase-like (LOC108067563), mRNA.
ACCESSION   XM_017156643
VERSION     XM_017156643.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156643.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..738
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..738
                     /gene="LOC108067563"
                     /note="9,11-endoperoxide prostaglandin H2 reductase-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:108067563"
     CDS             52..726
                     /gene="LOC108067563"
                     /codon_start=1
                     /product="9,11-endoperoxide prostaglandin H2
                     reductase-like"
                     /protein_id="XP_017012132.2"
                     /db_xref="GeneID:108067563"
                     /translation="MKLAPTVKLNNGYEMPVLGLGTYNSKDNEGEAAVKHAIDVGYRH
                     IDTAFLDTYKAMEKLVKLGLVRSIGVSNFNSEQLALVLANCEITPVTNQVECSPALNQ
                     KALTAFYKENGVTLTGYTPLGKPKPDIQKPDFIYSTEVAVIAKKYGKTAPQIVLRYLV
                     GLGVIPILKSSNTNRISENFDIFDSELTAEEMAVLDGFHTGEGVVPLNLIKGLSHKYY
                     PFAIEF"
     misc_feature    64..666
                     /gene="LOC108067563"
                     /note="Aldo-keto reductase (AKR) superfamily; Region:
                     AKR_SF; cl00470"
                     /db_xref="CDD:444925"
     misc_feature    order(112..120,187..189,262..267,328..330,406..426,
                     505..507,550..561,574..576,583..588)
                     /gene="LOC108067563"
                     /note="active site"
                     /db_xref="CDD:381296"
ORIGIN      
        1 ttattttttc ccccaatctt tattcattta ttctaaattt gaacgttaaa aatgaagctt
       61 gctccgactg taaaactgaa caatggctac gaaatgcctg ttttgggtct gggaacctac
      121 aattccaagg acaatgaagg cgaggccgcc gtaaagcacg cgatcgatgt gggctaccgt
      181 catatagaca cggccttttt ggatacctac aaggccatgg aaaagctggt gaaactgggg
      241 ctggtccgca gtatcggagt gtcgaacttc aatagcgagc agctggcact agttttggcc
      301 aactgcgaga tcacgccggt caccaaccag gtggagtgct ctcctgccct caatcagaag
      361 gctttgactg ccttttataa ggagaacggc gttactttga cgggctatac gcctttggga
      421 aagccgaagc ccgatatcca gaagccagac tttatctact cgacggaggt ggccgttatt
      481 gccaagaagt acggcaaaac tgccccgcag attgtcctgc gctatctggt tggcctcggc
      541 gtcatcccca tcctcaagtc atcgaatact aaccgaattt ccgaaaactt tgatatcttc
      601 gattctgaac tgaccgccga ggaaatggct gttctcgatg gctttcacac tggcgagggt
      661 gttgttccat tgaacttgat caagggcctt agccacaagt attatccgtt tgcaattgag
      721 ttctaaacca ggtgtagg