Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156643 738 bp mRNA linear INV 09-DEC-2024 reductase-like (LOC108067563), mRNA. ACCESSION XM_017156643 VERSION XM_017156643.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156643.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..738 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..738 /gene="LOC108067563" /note="9,11-endoperoxide prostaglandin H2 reductase-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108067563" CDS 52..726 /gene="LOC108067563" /codon_start=1 /product="9,11-endoperoxide prostaglandin H2 reductase-like" /protein_id="XP_017012132.2" /db_xref="GeneID:108067563" /translation="MKLAPTVKLNNGYEMPVLGLGTYNSKDNEGEAAVKHAIDVGYRH IDTAFLDTYKAMEKLVKLGLVRSIGVSNFNSEQLALVLANCEITPVTNQVECSPALNQ KALTAFYKENGVTLTGYTPLGKPKPDIQKPDFIYSTEVAVIAKKYGKTAPQIVLRYLV GLGVIPILKSSNTNRISENFDIFDSELTAEEMAVLDGFHTGEGVVPLNLIKGLSHKYY PFAIEF" misc_feature 64..666 /gene="LOC108067563" /note="Aldo-keto reductase (AKR) superfamily; Region: AKR_SF; cl00470" /db_xref="CDD:444925" misc_feature order(112..120,187..189,262..267,328..330,406..426, 505..507,550..561,574..576,583..588) /gene="LOC108067563" /note="active site" /db_xref="CDD:381296" ORIGIN 1 ttattttttc ccccaatctt tattcattta ttctaaattt gaacgttaaa aatgaagctt 61 gctccgactg taaaactgaa caatggctac gaaatgcctg ttttgggtct gggaacctac 121 aattccaagg acaatgaagg cgaggccgcc gtaaagcacg cgatcgatgt gggctaccgt 181 catatagaca cggccttttt ggatacctac aaggccatgg aaaagctggt gaaactgggg 241 ctggtccgca gtatcggagt gtcgaacttc aatagcgagc agctggcact agttttggcc 301 aactgcgaga tcacgccggt caccaaccag gtggagtgct ctcctgccct caatcagaag 361 gctttgactg ccttttataa ggagaacggc gttactttga cgggctatac gcctttggga 421 aagccgaagc ccgatatcca gaagccagac tttatctact cgacggaggt ggccgttatt 481 gccaagaagt acggcaaaac tgccccgcag attgtcctgc gctatctggt tggcctcggc 541 gtcatcccca tcctcaagtc atcgaatact aaccgaattt ccgaaaactt tgatatcttc 601 gattctgaac tgaccgccga ggaaatggct gttctcgatg gctttcacac tggcgagggt 661 gttgttccat tgaacttgat caagggcctt agccacaagt attatccgtt tgcaattgag 721 ttctaaacca ggtgtagg