Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156557 5204 bp mRNA linear INV 09-DEC-2024 variant X6, mRNA. ACCESSION XM_017156557 VERSION XM_017156557.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156557.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5204 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..5204 /gene="Fas2" /note="fasciclin 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108067511" CDS 414..2750 /gene="Fas2" /codon_start=1 /product="fasciclin-2 isoform X6" /protein_id="XP_017012046.2" /db_xref="GeneID:108067511" /translation="MGELRKSLPLNSVGVFLALLLCSCSLIELCQAQSPILEIYPKQE VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGES LALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYV VMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIET GELLERTIRVEVFIQPVIVSLPETLNAVEGKPFAANCTARGKPVPEISWIRDATQLNV ATADRFQVNPQTGLVTISSVTQEDYGTYTCLAKNKAGVVDQKTKLNVLVRPQIYELYN VTGARTKEIAITCRARGRPAPTITFRRWGSEEEFKTGQQFDDPRIILEPNYDQERGES TGTLRIANADRTDDGLYQCIARNSEDKAYKTGHITVEFAPDFSHMKELPPVFSWEQRK ANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKC IATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPPTELGLPILAFSVQ YKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTP RRSAPEEPKPLHQPEQHDTEEPVVVSTYSDHFELRWGVPADNGEPIDKYQIKYCPGVK ISGTWTELEDSCNTVEVVETTSYEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTR DNPHPSPSSGAAPLAQLLVLSAALPTMLLIMLPTTRTA" misc_feature 522..788 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 573..587 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409404" misc_feature 621..635 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409404" misc_feature 720..734 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409404" misc_feature 762..779 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409404" misc_feature 840..1052 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 891..902 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 927..941 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 993..1007 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1035..1052 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1110..1382 /gene="Fas2" /note="Fourth Ig-like domain from smooth muscle myosin light chain kinase and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_MYLK-like; cd20976" /db_xref="CDD:409568" misc_feature 1110..1121 /gene="Fas2" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409568" misc_feature 1137..1148 /gene="Fas2" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409568" misc_feature 1161..1187 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409568" misc_feature 1203..1217 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409568" misc_feature 1224..1235 /gene="Fas2" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409568" misc_feature 1254..1268 /gene="Fas2" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409568" misc_feature 1278..1295 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409568" misc_feature 1317..1343 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409568" misc_feature 1350..1382 /gene="Fas2" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409568" misc_feature 1413..1697 /gene="Fas2" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 1479..1532 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1593..1607 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1635..1652 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1764..1970 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cd00096" /db_xref="CDD:409353" misc_feature 1764..1778 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1803..1817 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1884..1898 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1926..1943 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1998..2282 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(1998..2000,2199..2201,2244..2246) /gene="Fas2" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(2247..2252,2256..2261) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2343..2630 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2595..2600,2604..2609) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" ORIGIN 1 gcgttcagtt acgtttcgac ggccaacgcg tcgagttgca acttttccgc ctgaaaaata 61 aaaatagcca ctggattgga agacagaact cagttctccc actctctcgc gctctcttca 121 ctgtctgtgt taacggtcgt ggcgcgtcgc gtgcgtgtgt gttagtgtgc cagttaaaca 181 atgagaaatt gattcacaca ccaaaacagc taaacaaaaa caccaaaaga cgaaaagtgt 241 taaccaaaaa aaataaataa tttgtgcaat cgcaaggaac gaaaagagac tacaattttt 301 taaacatttt tttcgtgtgc aaccgtaaac caaaccaaag aagctgaaaa gagagcaatc 361 aatttgcgag cggggaaaac tactactaat actgcaaaaa aaaagcgata aaaatgggtg 421 aactgcgaaa atcgctgccg ctgaattcgg tcggcgtctt tttggcgctg ctcctctgca 481 gctgctcttt aatagaactg tgccaggctc agtcgcccat cctggagatt taccccaaac 541 aagaggtgca gcgcaagcca gttggcaagc ccctgattct cacctgccga cccacagttc 601 ccgagccctc gctggtcgcc gatctgcaat ggaaggataa ccggaacaac accatcctgc 661 ccaagccgaa tggacgcaac cagccgccga tgtacacgga aacgctgccc ggcgaaagtt 721 tggccctgat gattacctcg ctgtcggtgg aaatgggcgg caagtactac tgcaccgcct 781 cctatgcaaa taccgagatc ctcgagaagg gcgtcacaat taaaacttac gtggccatta 841 cctggacaaa tgcccccgag aatcagtatc ccaccttggg ccaggattac gtggtgatgt 901 gtgaggttaa ggccgatccc aatccgacaa tcgactggct gcgcaacgga gatccgatcc 961 gcaccaccaa cgacaagtat gtggtgcaaa cgaacggcct gctgatccgc aatgtccagg 1021 agagtgacga aggcatctac acctgccggg cggcggtgat cgagacgggc gagctgctgg 1081 agcgcaccat tcgcgtggag gtcttcatcc agccggtgat tgtatcgctc ccggagactc 1141 tcaacgcggt cgagggcaaa ccctttgcgg ccaactgcac ggcgaggggc aaaccggtgc 1201 cggagatcag ctggattcgg gatgcgaccc aattgaacgt ggccaccgcc gatcgcttcc 1261 aggtgaatcc ccagacgggt cttgtgacca tcagttcggt tacccaggag gactacggca 1321 cctacacctg cttggcgaag aacaaggccg gcgtggttga ccagaagacc aagctgaatg 1381 tcctggtgcg tccgcagatc tacgaactgt acaatgtgac cggtgccagg accaaggaga 1441 tcgccatcac ctgccgcgcc cgcggacgtc cggcaccgac gatcaccttc cggcgttggg 1501 gcagcgagga ggagttcaag accggccagc agttcgacga tccccgtatt attttggagc 1561 ccaactacga ccaggagcgc ggcgagagca ccggcaccct gcgcatcgcc aatgccgatc 1621 gcaccgacga cggactgtac cagtgcattg cccggaattc ggaggacaag gcctacaaga 1681 ccggacacat caccgtcgag ttcgcccccg acttcagcca catgaaggag ctgccgccgg 1741 tcttctcgtg ggagcagcgc aaggccaatc tcagctgcct ggccatgggc atcccgaatg 1801 ccaccatcga atggcactgg aacggtcgca agatcaagga tctgtacgat accaatctga 1861 agatcgtggg cacgggacct cgcagcgatc tgattgtcca tccggtgacg aggcagtact 1921 actcgggcta caagtgcatt gccacgaata tccacggaac cgccgagcat gatatgcagc 1981 tgaaggaggc acgtgtccct gattttgtgt ccgaggctaa gcccagccaa ctgaccgcca 2041 ccacgatgac cttcgacatc cgaggcccgc ccaccgaact gggtctgccc attctggcgt 2101 tcagtgtgca gtacaaggag gccctcaatc cggactggtc gacggcctac aaccgcagct 2161 ggtcgcccga ttcgccgtac attgtggagg gactgcgacc gcagacggag tacagcttcc 2221 gcttcgccgc ccgcaaccag gtgggactgg gcaactgggg cgtcaaccag cagcagtcga 2281 cgccacgccg ctcggctccc gaggagccca agccactgca tcagcccgag cagcacgaca 2341 ccgaggagcc ggtggtcgtc tcgacctact ccgatcactt cgagctgcgc tggggggtgc 2401 cggccgacaa tggagagccc atcgacaagt accagatcaa atactgtccg ggcgtcaaga 2461 tcagcggcac ctggacggaa ctggaggact cctgcaatac cgtcgaggtg gtggagacca 2521 cctcctacga gatgacacag ctggtgggca acacctatta tcgcatcgaa ctgaaggcgc 2581 acaatgccat cggctattcg tcgccagctt ccatcattat gaagacgaca cgagataatc 2641 cgcatccttc gccttcgagt ggcgctgcac ccctggccca actgcttgtt cttagcgctg 2701 ctctgccgac aatgctgctg attatgctgc cgacgacgcg cactgcttaa gcgaccacag 2761 ctgccgatgc ttctcctgct tccacccatc aacaagcagt gctcggagga tccttccgct 2821 ggccgtttac catgggtttt cctttctcta gttttcgttt ggtgtgtcaa tgtgtaaata 2881 ataagaaaac taactaaaaa aaaacaaaaa aaaggaataa aataaaacat acacttaact 2941 agcaagaaga agcggacata attacgttaa atgtgctcaa gtagagaata tgatcaataa 3001 atatatcaca tagggcgggt cacgattcca ttaactgtac aaaaaaacca aaaacgaaaa 3061 tctatgatag tacctagttg aagaaaacag acaaacggaa tgccaaaacc gaaacacatg 3121 cttacacaac tgatcaattg tacttatatg tatcctatat cctatgtcta accgctagag 3181 accttgtttt accactaagc caatgttatg ttgttattta gttgtatgtg tatagcgaga 3241 gcatttatag aacacattcc gattccgtac acccgttccg cttagttcaa tgtgaatttt 3301 acaacactgc caagcgacac aaagaaaaaa agaaaaacca aagcctaaac caaatttata 3361 aatgagacgt tttagcgaaa ttctacaagg agaataagga atcgaaatat caagtgcata 3421 cgagtacaag ttacatttac actctatacc taacctaacc taaagttagc caaaaagctt 3481 cttccaacac tgtttttaag cagttgcgag cagtttagcc aggtcctgtt ctgttttcag 3541 tgcgtaaacg ttaagagggg acaataagta actctaacta agttaaagcg attacgaatt 3601 tttccacact agggggctca cgagtgtttt taccttctgt tgatagtaag cgtttaatag 3661 gccaaaacta gaatgcaact cgatctagac aaaccgatat tcctgtatac acgttttttt 3721 agcaagcgaa atcgattttt ctagccaaat atatatcgta aattcataaa aaaaaaagaa 3781 aactgataaa tacaatttat acctttacaa tatctagtta tacatacgta tacacatata 3841 gttagtgaat aattcagccc gcctaacgtt gctgagatgg ggaaagcgtt ttttttttaa 3901 acgcccttgg gcaagcagta ggaactttca ctgttctcac agatcacaat taaacacgat 3961 gtcatgaatg ttgtaagcaa atgaaaccga aaacaaaaac gaaaattggt aaatggaaac 4021 gaaaagaaag cctaccactt aagaagttca ttttgggtaa taaagagaaa actttaacag 4081 aaagcagtgc gtgcgtgtgt gacttgggac agggttgcca ccagcatttc ggatgccgcc 4141 aggtaacaaa aaggatgtgt ttaacgccta tatttgtatc tacttattat aacctgttca 4201 tttgcactgc acaccaacag ccgcagacac taacagctga acaaccaaca acaaaaatat 4261 tgtatacccc gaaaccagaa aaatctgttg ataacaaacc ttattgttga ttgttaattg 4321 ttgattatgt tatagtttta aaaaccgaag caaagcactc taggcaaacg attcccacta 4381 ccttctatat aattcccctc ccgcacacaa aatgtacata caaatacact tctatctaac 4441 ataaggtaaa atcaaatata tccttaagtt gaactgctta acactgcttg tatactttgc 4501 atattggcct atttatgtat tttgcaattt gtaaaaaaaa aaaactaaaa cacttttcca 4561 accaaccgct tctttttctc actctcaccg accactttct ctatttctgt gctgagcgaa 4621 aacccccaaa aaaatccctc caaccaaact tttccccacc ggctgcatgc tttatttgta 4681 aacccccact ttccagtccc ctttcgatat atggcaagaa aaaaaaaccg gagaccaaaa 4741 aaatgaaaat tcatattgct aagtttgttg ctttgtttga aaatgctttt catgttatgt 4801 caattggtgc gatttaaaat tgattttgta cttccctctt atattttttg gttattatga 4861 ttgctactac tattattgta actgttatga tttcgttatg tttaatctta gtttcgacta 4921 atttcaacca caaaataata cacacacaaa aatgtaaaat acgtttaaac gattaaccag 4981 cgattaagaa gcagagtttt aagtgtgtaa gattagctgt taattggagg agatttccta 5041 ggctagtgag ccaggtgctg gcaccgtacc acctagagat acgtatagtt aacaccccct 5101 tcccctataa agcgatctga atctgaatga caacttacta atcgagtaca cttgttttcc 5161 cccatccgca tcccgccttc cgtctgcacc ttctctaatc cgaa