Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156556 5250 bp mRNA linear INV 09-DEC-2024 variant X5, mRNA. ACCESSION XM_017156556 VERSION XM_017156556.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156556.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5250 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..5250 /gene="Fas2" /note="fasciclin 2; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108067511" CDS 414..2795 /gene="Fas2" /codon_start=1 /product="fasciclin-2 isoform X5" /protein_id="XP_017012045.2" /db_xref="GeneID:108067511" /translation="MGELRKSLPLNSVGVFLALLLCSCSLIELCQAQSPILEIYPKQE VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNYDPLYDSKGNRKKENG RNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWT NAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQE SDEGIYTCRAAVIETGELLERTIRVEVFIQPVIVSLPETLNAVEGKPFAANCTARGKP VPEISWIRDATQLNVATADRFQVNPQTGLVTISSVTQEDYGTYTCLAKNKAGVVDQKT KLNVLVRPQIYELYNVTGARTKEIAITCRARGRPAPTITFRRWGSEEEFKTGQQFDDP RIILEPNYDQERGESTGTLRIANADRTDDGLYQCIARNSEDKAYKTGHITVEFAPDFS HMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDL IVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRG PPTELGLPILAFSVQYKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQ VGLGNWGVNQQQSTPRRSAPEEPKPLHQPEQHDTEEPVVVSTYSDHFELRWGVPADNG EPIDKYQIKYCPGVKISGTWTELEDSCNTVEVVETTSYEMTQLVGNTYYRIELKAHNA IGYSSPASIIMKTTRDNPHPSPSSGAAPLAQLLVLSAALPTMLLIMLPTTRTA" misc_feature 522..833 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 573..587 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409404" misc_feature 621..635 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409404" misc_feature 765..779 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409404" misc_feature 807..824 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409404" misc_feature 885..1097 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 936..947 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 972..986 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 1038..1052 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1080..1097 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1155..1427 /gene="Fas2" /note="Fourth Ig-like domain from smooth muscle myosin light chain kinase and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_MYLK-like; cd20976" /db_xref="CDD:409568" misc_feature 1155..1166 /gene="Fas2" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409568" misc_feature 1182..1193 /gene="Fas2" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409568" misc_feature 1206..1232 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409568" misc_feature 1248..1262 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409568" misc_feature 1269..1280 /gene="Fas2" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409568" misc_feature 1299..1313 /gene="Fas2" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409568" misc_feature 1323..1340 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409568" misc_feature 1362..1388 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409568" misc_feature 1395..1427 /gene="Fas2" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409568" misc_feature 1458..1742 /gene="Fas2" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 1524..1577 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1638..1652 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1680..1697 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1809..2015 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cd00096" /db_xref="CDD:409353" misc_feature 1809..1823 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1848..1862 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1929..1943 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1971..1988 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2043..2327 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2043..2045,2244..2246,2289..2291) /gene="Fas2" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(2292..2297,2301..2306) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2388..2675 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2640..2645,2649..2654) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" ORIGIN 1 gcgttcagtt acgtttcgac ggccaacgcg tcgagttgca acttttccgc ctgaaaaata 61 aaaatagcca ctggattgga agacagaact cagttctccc actctctcgc gctctcttca 121 ctgtctgtgt taacggtcgt ggcgcgtcgc gtgcgtgtgt gttagtgtgc cagttaaaca 181 atgagaaatt gattcacaca ccaaaacagc taaacaaaaa caccaaaaga cgaaaagtgt 241 taaccaaaaa aaataaataa tttgtgcaat cgcaaggaac gaaaagagac tacaattttt 301 taaacatttt tttcgtgtgc aaccgtaaac caaaccaaag aagctgaaaa gagagcaatc 361 aatttgcgag cggggaaaac tactactaat actgcaaaaa aaaagcgata aaaatgggtg 421 aactgcgaaa atcgctgccg ctgaattcgg tcggcgtctt tttggcgctg ctcctctgca 481 gctgctcttt aatagaactg tgccaggctc agtcgcccat cctggagatt taccccaaac 541 aagaggtgca gcgcaagcca gttggcaagc ccctgattct cacctgccga cccacagttc 601 ccgagccctc gctggtcgcc gatctgcaat ggaaggataa ccggaacaac accatcctgc 661 ccaagccgaa ttacgatcca ctgtatgatt ccaagggcaa tagaaagaaa gagaatggac 721 gcaaccagcc gccgatgtac acggaaacgc tgcccggcga aagtttggcc ctgatgatta 781 cctcgctgtc ggtggaaatg ggcggcaagt actactgcac cgcctcctat gcaaataccg 841 agatcctcga gaagggcgtc acaattaaaa cttacgtggc cattacctgg acaaatgccc 901 ccgagaatca gtatcccacc ttgggccagg attacgtggt gatgtgtgag gttaaggccg 961 atcccaatcc gacaatcgac tggctgcgca acggagatcc gatccgcacc accaacgaca 1021 agtatgtggt gcaaacgaac ggcctgctga tccgcaatgt ccaggagagt gacgaaggca 1081 tctacacctg ccgggcggcg gtgatcgaga cgggcgagct gctggagcgc accattcgcg 1141 tggaggtctt catccagccg gtgattgtat cgctcccgga gactctcaac gcggtcgagg 1201 gcaaaccctt tgcggccaac tgcacggcga ggggcaaacc ggtgccggag atcagctgga 1261 ttcgggatgc gacccaattg aacgtggcca ccgccgatcg cttccaggtg aatccccaga 1321 cgggtcttgt gaccatcagt tcggttaccc aggaggacta cggcacctac acctgcttgg 1381 cgaagaacaa ggccggcgtg gttgaccaga agaccaagct gaatgtcctg gtgcgtccgc 1441 agatctacga actgtacaat gtgaccggtg ccaggaccaa ggagatcgcc atcacctgcc 1501 gcgcccgcgg acgtccggca ccgacgatca ccttccggcg ttggggcagc gaggaggagt 1561 tcaagaccgg ccagcagttc gacgatcccc gtattatttt ggagcccaac tacgaccagg 1621 agcgcggcga gagcaccggc accctgcgca tcgccaatgc cgatcgcacc gacgacggac 1681 tgtaccagtg cattgcccgg aattcggagg acaaggccta caagaccgga cacatcaccg 1741 tcgagttcgc ccccgacttc agccacatga aggagctgcc gccggtcttc tcgtgggagc 1801 agcgcaaggc caatctcagc tgcctggcca tgggcatccc gaatgccacc atcgaatggc 1861 actggaacgg tcgcaagatc aaggatctgt acgataccaa tctgaagatc gtgggcacgg 1921 gacctcgcag cgatctgatt gtccatccgg tgacgaggca gtactactcg ggctacaagt 1981 gcattgccac gaatatccac ggaaccgccg agcatgatat gcagctgaag gaggcacgtg 2041 tccctgattt tgtgtccgag gctaagccca gccaactgac cgccaccacg atgaccttcg 2101 acatccgagg cccgcccacc gaactgggtc tgcccattct ggcgttcagt gtgcagtaca 2161 aggaggccct caatccggac tggtcgacgg cctacaaccg cagctggtcg cccgattcgc 2221 cgtacattgt ggagggactg cgaccgcaga cggagtacag cttccgcttc gccgcccgca 2281 accaggtggg actgggcaac tggggcgtca accagcagca gtcgacgcca cgccgctcgg 2341 ctcccgagga gcccaagcca ctgcatcagc ccgagcagca cgacaccgag gagccggtgg 2401 tcgtctcgac ctactccgat cacttcgagc tgcgctgggg ggtgccggcc gacaatggag 2461 agcccatcga caagtaccag atcaaatact gtccgggcgt caagatcagc ggcacctgga 2521 cggaactgga ggactcctgc aataccgtcg aggtggtgga gaccacctcc tacgagatga 2581 cacagctggt gggcaacacc tattatcgca tcgaactgaa ggcgcacaat gccatcggct 2641 attcgtcgcc agcttccatc attatgaaga cgacacgaga taatccgcat ccttcgcctt 2701 cgagtggcgc tgcacccctg gcccaactgc ttgttcttag cgctgctctg ccgacaatgc 2761 tgctgattat gctgccgacg acgcgcactg cttaagcgac cacagctgcc gatgcttctc 2821 ctgcttccac ccatcaacaa gcagtgctcg gaggatcctt ccgctggccg tttaccatgg 2881 gttttccttt ctctagtttt cgtttggtgt gtcaatgtgt aaataataag aaaactaact 2941 aaaaaaaaac aaaaaaaagg aataaaataa aacatacact taactagcaa gaagaagcgg 3001 acataattac gttaaatgtg ctcaagtaga gaatatgatc aataaatata tcacataggg 3061 cgggtcacga ttccattaac tgtacaaaaa aaccaaaaac gaaaatctat gatagtacct 3121 agttgaagaa aacagacaaa cggaatgcca aaaccgaaac acatgcttac acaactgatc 3181 aattgtactt atatgtatcc tatatcctat gtctaaccgc tagagacctt gttttaccac 3241 taagccaatg ttatgttgtt atttagttgt atgtgtatag cgagagcatt tatagaacac 3301 attccgattc cgtacacccg ttccgcttag ttcaatgtga attttacaac actgccaagc 3361 gacacaaaga aaaaaagaaa aaccaaagcc taaaccaaat ttataaatga gacgttttag 3421 cgaaattcta caaggagaat aaggaatcga aatatcaagt gcatacgagt acaagttaca 3481 tttacactct atacctaacc taacctaaag ttagccaaaa agcttcttcc aacactgttt 3541 ttaagcagtt gcgagcagtt tagccaggtc ctgttctgtt ttcagtgcgt aaacgttaag 3601 aggggacaat aagtaactct aactaagtta aagcgattac gaatttttcc acactagggg 3661 gctcacgagt gtttttacct tctgttgata gtaagcgttt aataggccaa aactagaatg 3721 caactcgatc tagacaaacc gatattcctg tatacacgtt tttttagcaa gcgaaatcga 3781 tttttctagc caaatatata tcgtaaattc ataaaaaaaa aagaaaactg ataaatacaa 3841 tttatacctt tacaatatct agttatacat acgtatacac atatagttag tgaataattc 3901 agcccgccta acgttgctga gatggggaaa gcgttttttt tttaaacgcc cttgggcaag 3961 cagtaggaac tttcactgtt ctcacagatc acaattaaac acgatgtcat gaatgttgta 4021 agcaaatgaa accgaaaaca aaaacgaaaa ttggtaaatg gaaacgaaaa gaaagcctac 4081 cacttaagaa gttcattttg ggtaataaag agaaaacttt aacagaaagc agtgcgtgcg 4141 tgtgtgactt gggacagggt tgccaccagc atttcggatg ccgccaggta acaaaaagga 4201 tgtgtttaac gcctatattt gtatctactt attataacct gttcatttgc actgcacacc 4261 aacagccgca gacactaaca gctgaacaac caacaacaaa aatattgtat accccgaaac 4321 cagaaaaatc tgttgataac aaaccttatt gttgattgtt aattgttgat tatgttatag 4381 ttttaaaaac cgaagcaaag cactctaggc aaacgattcc cactaccttc tatataattc 4441 ccctcccgca cacaaaatgt acatacaaat acacttctat ctaacataag gtaaaatcaa 4501 atatatcctt aagttgaact gcttaacact gcttgtatac tttgcatatt ggcctattta 4561 tgtattttgc aatttgtaaa aaaaaaaaac taaaacactt ttccaaccaa ccgcttcttt 4621 ttctcactct caccgaccac tttctctatt tctgtgctga gcgaaaaccc ccaaaaaaat 4681 ccctccaacc aaacttttcc ccaccggctg catgctttat ttgtaaaccc ccactttcca 4741 gtcccctttc gatatatggc aagaaaaaaa aaccggagac caaaaaaatg aaaattcata 4801 ttgctaagtt tgttgctttg tttgaaaatg cttttcatgt tatgtcaatt ggtgcgattt 4861 aaaattgatt ttgtacttcc ctcttatatt ttttggttat tatgattgct actactatta 4921 ttgtaactgt tatgatttcg ttatgtttaa tcttagtttc gactaatttc aaccacaaaa 4981 taatacacac acaaaaatgt aaaatacgtt taaacgatta accagcgatt aagaagcaga 5041 gttttaagtg tgtaagatta gctgttaatt ggaggagatt tcctaggcta gtgagccagg 5101 tgctggcacc gtaccaccta gagatacgta tagttaacac ccccttcccc tataaagcga 5161 tctgaatctg aatgacaact tactaatcga gtacacttgt tttcccccat ccgcatcccg 5221 ccttccgtct gcaccttctc taatccgaaa