Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii fasciclin 2 (Fas2), transcript


LOCUS       XM_017156556            5250 bp    mRNA    linear   INV 09-DEC-2024
            variant X5, mRNA.
ACCESSION   XM_017156556
VERSION     XM_017156556.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156556.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5250
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..5250
                     /gene="Fas2"
                     /note="fasciclin 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:108067511"
     CDS             414..2795
                     /gene="Fas2"
                     /codon_start=1
                     /product="fasciclin-2 isoform X5"
                     /protein_id="XP_017012045.2"
                     /db_xref="GeneID:108067511"
                     /translation="MGELRKSLPLNSVGVFLALLLCSCSLIELCQAQSPILEIYPKQE
                     VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNYDPLYDSKGNRKKENG
                     RNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWT
                     NAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQE
                     SDEGIYTCRAAVIETGELLERTIRVEVFIQPVIVSLPETLNAVEGKPFAANCTARGKP
                     VPEISWIRDATQLNVATADRFQVNPQTGLVTISSVTQEDYGTYTCLAKNKAGVVDQKT
                     KLNVLVRPQIYELYNVTGARTKEIAITCRARGRPAPTITFRRWGSEEEFKTGQQFDDP
                     RIILEPNYDQERGESTGTLRIANADRTDDGLYQCIARNSEDKAYKTGHITVEFAPDFS
                     HMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDL
                     IVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRG
                     PPTELGLPILAFSVQYKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQ
                     VGLGNWGVNQQQSTPRRSAPEEPKPLHQPEQHDTEEPVVVSTYSDHFELRWGVPADNG
                     EPIDKYQIKYCPGVKISGTWTELEDSCNTVEVVETTSYEMTQLVGNTYYRIELKAHNA
                     IGYSSPASIIMKTTRDNPHPSPSSGAAPLAQLLVLSAALPTMLLIMLPTTRTA"
     misc_feature    522..833
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    573..587
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409404"
     misc_feature    621..635
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409404"
     misc_feature    765..779
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409404"
     misc_feature    807..824
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409404"
     misc_feature    885..1097
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    936..947
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    972..986
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    1038..1052
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    1080..1097
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    1155..1427
                     /gene="Fas2"
                     /note="Fourth Ig-like domain from smooth muscle myosin
                     light chain kinase and similar domains; a member of the
                     I-set of IgSF domains; Region: IgI_4_MYLK-like; cd20976"
                     /db_xref="CDD:409568"
     misc_feature    1155..1166
                     /gene="Fas2"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409568"
     misc_feature    1182..1193
                     /gene="Fas2"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409568"
     misc_feature    1206..1232
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409568"
     misc_feature    1248..1262
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409568"
     misc_feature    1269..1280
                     /gene="Fas2"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409568"
     misc_feature    1299..1313
                     /gene="Fas2"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409568"
     misc_feature    1323..1340
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409568"
     misc_feature    1362..1388
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409568"
     misc_feature    1395..1427
                     /gene="Fas2"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409568"
     misc_feature    1458..1742
                     /gene="Fas2"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    1524..1577
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1638..1652
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1680..1697
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1809..2015
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cd00096"
                     /db_xref="CDD:409353"
     misc_feature    1809..1823
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1848..1862
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1929..1943
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1971..1988
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2043..2327
                     /gene="Fas2"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(2043..2045,2244..2246,2289..2291)
                     /gene="Fas2"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(2292..2297,2301..2306)
                     /gene="Fas2"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2388..2675
                     /gene="Fas2"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(2640..2645,2649..2654)
                     /gene="Fas2"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
ORIGIN      
        1 gcgttcagtt acgtttcgac ggccaacgcg tcgagttgca acttttccgc ctgaaaaata
       61 aaaatagcca ctggattgga agacagaact cagttctccc actctctcgc gctctcttca
      121 ctgtctgtgt taacggtcgt ggcgcgtcgc gtgcgtgtgt gttagtgtgc cagttaaaca
      181 atgagaaatt gattcacaca ccaaaacagc taaacaaaaa caccaaaaga cgaaaagtgt
      241 taaccaaaaa aaataaataa tttgtgcaat cgcaaggaac gaaaagagac tacaattttt
      301 taaacatttt tttcgtgtgc aaccgtaaac caaaccaaag aagctgaaaa gagagcaatc
      361 aatttgcgag cggggaaaac tactactaat actgcaaaaa aaaagcgata aaaatgggtg
      421 aactgcgaaa atcgctgccg ctgaattcgg tcggcgtctt tttggcgctg ctcctctgca
      481 gctgctcttt aatagaactg tgccaggctc agtcgcccat cctggagatt taccccaaac
      541 aagaggtgca gcgcaagcca gttggcaagc ccctgattct cacctgccga cccacagttc
      601 ccgagccctc gctggtcgcc gatctgcaat ggaaggataa ccggaacaac accatcctgc
      661 ccaagccgaa ttacgatcca ctgtatgatt ccaagggcaa tagaaagaaa gagaatggac
      721 gcaaccagcc gccgatgtac acggaaacgc tgcccggcga aagtttggcc ctgatgatta
      781 cctcgctgtc ggtggaaatg ggcggcaagt actactgcac cgcctcctat gcaaataccg
      841 agatcctcga gaagggcgtc acaattaaaa cttacgtggc cattacctgg acaaatgccc
      901 ccgagaatca gtatcccacc ttgggccagg attacgtggt gatgtgtgag gttaaggccg
      961 atcccaatcc gacaatcgac tggctgcgca acggagatcc gatccgcacc accaacgaca
     1021 agtatgtggt gcaaacgaac ggcctgctga tccgcaatgt ccaggagagt gacgaaggca
     1081 tctacacctg ccgggcggcg gtgatcgaga cgggcgagct gctggagcgc accattcgcg
     1141 tggaggtctt catccagccg gtgattgtat cgctcccgga gactctcaac gcggtcgagg
     1201 gcaaaccctt tgcggccaac tgcacggcga ggggcaaacc ggtgccggag atcagctgga
     1261 ttcgggatgc gacccaattg aacgtggcca ccgccgatcg cttccaggtg aatccccaga
     1321 cgggtcttgt gaccatcagt tcggttaccc aggaggacta cggcacctac acctgcttgg
     1381 cgaagaacaa ggccggcgtg gttgaccaga agaccaagct gaatgtcctg gtgcgtccgc
     1441 agatctacga actgtacaat gtgaccggtg ccaggaccaa ggagatcgcc atcacctgcc
     1501 gcgcccgcgg acgtccggca ccgacgatca ccttccggcg ttggggcagc gaggaggagt
     1561 tcaagaccgg ccagcagttc gacgatcccc gtattatttt ggagcccaac tacgaccagg
     1621 agcgcggcga gagcaccggc accctgcgca tcgccaatgc cgatcgcacc gacgacggac
     1681 tgtaccagtg cattgcccgg aattcggagg acaaggccta caagaccgga cacatcaccg
     1741 tcgagttcgc ccccgacttc agccacatga aggagctgcc gccggtcttc tcgtgggagc
     1801 agcgcaaggc caatctcagc tgcctggcca tgggcatccc gaatgccacc atcgaatggc
     1861 actggaacgg tcgcaagatc aaggatctgt acgataccaa tctgaagatc gtgggcacgg
     1921 gacctcgcag cgatctgatt gtccatccgg tgacgaggca gtactactcg ggctacaagt
     1981 gcattgccac gaatatccac ggaaccgccg agcatgatat gcagctgaag gaggcacgtg
     2041 tccctgattt tgtgtccgag gctaagccca gccaactgac cgccaccacg atgaccttcg
     2101 acatccgagg cccgcccacc gaactgggtc tgcccattct ggcgttcagt gtgcagtaca
     2161 aggaggccct caatccggac tggtcgacgg cctacaaccg cagctggtcg cccgattcgc
     2221 cgtacattgt ggagggactg cgaccgcaga cggagtacag cttccgcttc gccgcccgca
     2281 accaggtggg actgggcaac tggggcgtca accagcagca gtcgacgcca cgccgctcgg
     2341 ctcccgagga gcccaagcca ctgcatcagc ccgagcagca cgacaccgag gagccggtgg
     2401 tcgtctcgac ctactccgat cacttcgagc tgcgctgggg ggtgccggcc gacaatggag
     2461 agcccatcga caagtaccag atcaaatact gtccgggcgt caagatcagc ggcacctgga
     2521 cggaactgga ggactcctgc aataccgtcg aggtggtgga gaccacctcc tacgagatga
     2581 cacagctggt gggcaacacc tattatcgca tcgaactgaa ggcgcacaat gccatcggct
     2641 attcgtcgcc agcttccatc attatgaaga cgacacgaga taatccgcat ccttcgcctt
     2701 cgagtggcgc tgcacccctg gcccaactgc ttgttcttag cgctgctctg ccgacaatgc
     2761 tgctgattat gctgccgacg acgcgcactg cttaagcgac cacagctgcc gatgcttctc
     2821 ctgcttccac ccatcaacaa gcagtgctcg gaggatcctt ccgctggccg tttaccatgg
     2881 gttttccttt ctctagtttt cgtttggtgt gtcaatgtgt aaataataag aaaactaact
     2941 aaaaaaaaac aaaaaaaagg aataaaataa aacatacact taactagcaa gaagaagcgg
     3001 acataattac gttaaatgtg ctcaagtaga gaatatgatc aataaatata tcacataggg
     3061 cgggtcacga ttccattaac tgtacaaaaa aaccaaaaac gaaaatctat gatagtacct
     3121 agttgaagaa aacagacaaa cggaatgcca aaaccgaaac acatgcttac acaactgatc
     3181 aattgtactt atatgtatcc tatatcctat gtctaaccgc tagagacctt gttttaccac
     3241 taagccaatg ttatgttgtt atttagttgt atgtgtatag cgagagcatt tatagaacac
     3301 attccgattc cgtacacccg ttccgcttag ttcaatgtga attttacaac actgccaagc
     3361 gacacaaaga aaaaaagaaa aaccaaagcc taaaccaaat ttataaatga gacgttttag
     3421 cgaaattcta caaggagaat aaggaatcga aatatcaagt gcatacgagt acaagttaca
     3481 tttacactct atacctaacc taacctaaag ttagccaaaa agcttcttcc aacactgttt
     3541 ttaagcagtt gcgagcagtt tagccaggtc ctgttctgtt ttcagtgcgt aaacgttaag
     3601 aggggacaat aagtaactct aactaagtta aagcgattac gaatttttcc acactagggg
     3661 gctcacgagt gtttttacct tctgttgata gtaagcgttt aataggccaa aactagaatg
     3721 caactcgatc tagacaaacc gatattcctg tatacacgtt tttttagcaa gcgaaatcga
     3781 tttttctagc caaatatata tcgtaaattc ataaaaaaaa aagaaaactg ataaatacaa
     3841 tttatacctt tacaatatct agttatacat acgtatacac atatagttag tgaataattc
     3901 agcccgccta acgttgctga gatggggaaa gcgttttttt tttaaacgcc cttgggcaag
     3961 cagtaggaac tttcactgtt ctcacagatc acaattaaac acgatgtcat gaatgttgta
     4021 agcaaatgaa accgaaaaca aaaacgaaaa ttggtaaatg gaaacgaaaa gaaagcctac
     4081 cacttaagaa gttcattttg ggtaataaag agaaaacttt aacagaaagc agtgcgtgcg
     4141 tgtgtgactt gggacagggt tgccaccagc atttcggatg ccgccaggta acaaaaagga
     4201 tgtgtttaac gcctatattt gtatctactt attataacct gttcatttgc actgcacacc
     4261 aacagccgca gacactaaca gctgaacaac caacaacaaa aatattgtat accccgaaac
     4321 cagaaaaatc tgttgataac aaaccttatt gttgattgtt aattgttgat tatgttatag
     4381 ttttaaaaac cgaagcaaag cactctaggc aaacgattcc cactaccttc tatataattc
     4441 ccctcccgca cacaaaatgt acatacaaat acacttctat ctaacataag gtaaaatcaa
     4501 atatatcctt aagttgaact gcttaacact gcttgtatac tttgcatatt ggcctattta
     4561 tgtattttgc aatttgtaaa aaaaaaaaac taaaacactt ttccaaccaa ccgcttcttt
     4621 ttctcactct caccgaccac tttctctatt tctgtgctga gcgaaaaccc ccaaaaaaat
     4681 ccctccaacc aaacttttcc ccaccggctg catgctttat ttgtaaaccc ccactttcca
     4741 gtcccctttc gatatatggc aagaaaaaaa aaccggagac caaaaaaatg aaaattcata
     4801 ttgctaagtt tgttgctttg tttgaaaatg cttttcatgt tatgtcaatt ggtgcgattt
     4861 aaaattgatt ttgtacttcc ctcttatatt ttttggttat tatgattgct actactatta
     4921 ttgtaactgt tatgatttcg ttatgtttaa tcttagtttc gactaatttc aaccacaaaa
     4981 taatacacac acaaaaatgt aaaatacgtt taaacgatta accagcgatt aagaagcaga
     5041 gttttaagtg tgtaagatta gctgttaatt ggaggagatt tcctaggcta gtgagccagg
     5101 tgctggcacc gtaccaccta gagatacgta tagttaacac ccccttcccc tataaagcga
     5161 tctgaatctg aatgacaact tactaatcga gtacacttgt tttcccccat ccgcatcccg
     5221 ccttccgtct gcaccttctc taatccgaaa