Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii fasciclin 2 (Fas2), transcript


LOCUS       XM_017156554            4870 bp    mRNA    linear   INV 09-DEC-2024
            variant X4, mRNA.
ACCESSION   XM_017156554
VERSION     XM_017156554.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156554.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4870
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..4870
                     /gene="Fas2"
                     /note="fasciclin 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108067511"
     CDS             414..2960
                     /gene="Fas2"
                     /codon_start=1
                     /product="fasciclin-2 isoform X4"
                     /protein_id="XP_017012043.2"
                     /db_xref="GeneID:108067511"
                     /translation="MGELRKSLPLNSVGVFLALLLCSCSLIELCQAQSPILEIYPKQE
                     VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGES
                     LALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYV
                     VMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIET
                     GELLERTIRVEVFIQPVIVSLPETLNAVEGKPFAANCTARGKPVPEISWIRDATQLNV
                     ATADRFQVNPQTGLVTISSVTQEDYGTYTCLAKNKAGVVDQKTKLNVLVRPQIYELYN
                     VTGARTKEIAITCRARGRPAPTITFRRWGSEEEFKTGQQFDDPRIILEPNYDQERGES
                     TGTLRIANADRTDDGLYQCIARNSEDKAYKTGHITVEFAPDFSHMKELPPVFSWEQRK
                     ANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKC
                     IATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPPTELGLPILAFSVQ
                     YKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTP
                     RRSAPEEPKPLHQPEQHDTEEPVVVSTYSDHFELRWGVPADNGEPIDKYQIKYCPGVK
                     ISGTWTELEDSCNTVEVVETTSYEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTR
                     GLDVIQVADRQVFSSAAIVGIALGGVLLLLFVVDFLCCITVHMGVMATMCRKAKRSPS
                     EIDDEAKLGRDEKEPLRTPTGSIKQNSTIEFDGRFVHSRSGEIIGKNSAV"
     misc_feature    522..788
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    573..587
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409404"
     misc_feature    621..635
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409404"
     misc_feature    720..734
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409404"
     misc_feature    762..779
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409404"
     misc_feature    840..1052
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    891..902
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    927..941
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    993..1007
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    1035..1052
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    1110..1382
                     /gene="Fas2"
                     /note="Fourth Ig-like domain from smooth muscle myosin
                     light chain kinase and similar domains; a member of the
                     I-set of IgSF domains; Region: IgI_4_MYLK-like; cd20976"
                     /db_xref="CDD:409568"
     misc_feature    1110..1121
                     /gene="Fas2"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409568"
     misc_feature    1137..1148
                     /gene="Fas2"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409568"
     misc_feature    1161..1187
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409568"
     misc_feature    1203..1217
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409568"
     misc_feature    1224..1235
                     /gene="Fas2"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409568"
     misc_feature    1254..1268
                     /gene="Fas2"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409568"
     misc_feature    1278..1295
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409568"
     misc_feature    1317..1343
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409568"
     misc_feature    1350..1382
                     /gene="Fas2"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409568"
     misc_feature    1413..1697
                     /gene="Fas2"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    1479..1532
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1593..1607
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1635..1652
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1764..1970
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cd00096"
                     /db_xref="CDD:409353"
     misc_feature    1764..1778
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1803..1817
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1884..1898
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1926..1943
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1998..2282
                     /gene="Fas2"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(1998..2000,2199..2201,2244..2246)
                     /gene="Fas2"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(2247..2252,2256..2261)
                     /gene="Fas2"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2343..2630
                     /gene="Fas2"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(2595..2600,2604..2609)
                     /gene="Fas2"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     polyA_site      4870
                     /gene="Fas2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcgttcagtt acgtttcgac ggccaacgcg tcgagttgca acttttccgc ctgaaaaata
       61 aaaatagcca ctggattgga agacagaact cagttctccc actctctcgc gctctcttca
      121 ctgtctgtgt taacggtcgt ggcgcgtcgc gtgcgtgtgt gttagtgtgc cagttaaaca
      181 atgagaaatt gattcacaca ccaaaacagc taaacaaaaa caccaaaaga cgaaaagtgt
      241 taaccaaaaa aaataaataa tttgtgcaat cgcaaggaac gaaaagagac tacaattttt
      301 taaacatttt tttcgtgtgc aaccgtaaac caaaccaaag aagctgaaaa gagagcaatc
      361 aatttgcgag cggggaaaac tactactaat actgcaaaaa aaaagcgata aaaatgggtg
      421 aactgcgaaa atcgctgccg ctgaattcgg tcggcgtctt tttggcgctg ctcctctgca
      481 gctgctcttt aatagaactg tgccaggctc agtcgcccat cctggagatt taccccaaac
      541 aagaggtgca gcgcaagcca gttggcaagc ccctgattct cacctgccga cccacagttc
      601 ccgagccctc gctggtcgcc gatctgcaat ggaaggataa ccggaacaac accatcctgc
      661 ccaagccgaa tggacgcaac cagccgccga tgtacacgga aacgctgccc ggcgaaagtt
      721 tggccctgat gattacctcg ctgtcggtgg aaatgggcgg caagtactac tgcaccgcct
      781 cctatgcaaa taccgagatc ctcgagaagg gcgtcacaat taaaacttac gtggccatta
      841 cctggacaaa tgcccccgag aatcagtatc ccaccttggg ccaggattac gtggtgatgt
      901 gtgaggttaa ggccgatccc aatccgacaa tcgactggct gcgcaacgga gatccgatcc
      961 gcaccaccaa cgacaagtat gtggtgcaaa cgaacggcct gctgatccgc aatgtccagg
     1021 agagtgacga aggcatctac acctgccggg cggcggtgat cgagacgggc gagctgctgg
     1081 agcgcaccat tcgcgtggag gtcttcatcc agccggtgat tgtatcgctc ccggagactc
     1141 tcaacgcggt cgagggcaaa ccctttgcgg ccaactgcac ggcgaggggc aaaccggtgc
     1201 cggagatcag ctggattcgg gatgcgaccc aattgaacgt ggccaccgcc gatcgcttcc
     1261 aggtgaatcc ccagacgggt cttgtgacca tcagttcggt tacccaggag gactacggca
     1321 cctacacctg cttggcgaag aacaaggccg gcgtggttga ccagaagacc aagctgaatg
     1381 tcctggtgcg tccgcagatc tacgaactgt acaatgtgac cggtgccagg accaaggaga
     1441 tcgccatcac ctgccgcgcc cgcggacgtc cggcaccgac gatcaccttc cggcgttggg
     1501 gcagcgagga ggagttcaag accggccagc agttcgacga tccccgtatt attttggagc
     1561 ccaactacga ccaggagcgc ggcgagagca ccggcaccct gcgcatcgcc aatgccgatc
     1621 gcaccgacga cggactgtac cagtgcattg cccggaattc ggaggacaag gcctacaaga
     1681 ccggacacat caccgtcgag ttcgcccccg acttcagcca catgaaggag ctgccgccgg
     1741 tcttctcgtg ggagcagcgc aaggccaatc tcagctgcct ggccatgggc atcccgaatg
     1801 ccaccatcga atggcactgg aacggtcgca agatcaagga tctgtacgat accaatctga
     1861 agatcgtggg cacgggacct cgcagcgatc tgattgtcca tccggtgacg aggcagtact
     1921 actcgggcta caagtgcatt gccacgaata tccacggaac cgccgagcat gatatgcagc
     1981 tgaaggaggc acgtgtccct gattttgtgt ccgaggctaa gcccagccaa ctgaccgcca
     2041 ccacgatgac cttcgacatc cgaggcccgc ccaccgaact gggtctgccc attctggcgt
     2101 tcagtgtgca gtacaaggag gccctcaatc cggactggtc gacggcctac aaccgcagct
     2161 ggtcgcccga ttcgccgtac attgtggagg gactgcgacc gcagacggag tacagcttcc
     2221 gcttcgccgc ccgcaaccag gtgggactgg gcaactgggg cgtcaaccag cagcagtcga
     2281 cgccacgccg ctcggctccc gaggagccca agccactgca tcagcccgag cagcacgaca
     2341 ccgaggagcc ggtggtcgtc tcgacctact ccgatcactt cgagctgcgc tggggggtgc
     2401 cggccgacaa tggagagccc atcgacaagt accagatcaa atactgtccg ggcgtcaaga
     2461 tcagcggcac ctggacggaa ctggaggact cctgcaatac cgtcgaggtg gtggagacca
     2521 cctcctacga gatgacacag ctggtgggca acacctatta tcgcatcgaa ctgaaggcgc
     2581 acaatgccat cggctattcg tcgccagctt ccatcattat gaagacgaca cgaggactcg
     2641 acgttatcca ggtggctgac cgacaggtct tctcctcggc ggccatcgtg ggcatcgcac
     2701 tcggcggcgt ccttctgctc ctcttcgtgg tggacttcct gtgctgcatc accgtccaca
     2761 tgggcgtcat ggccaccatg tgccgcaagg ccaagcgatc gccctccgag atcgacgacg
     2821 aggccaagct gggcagggac gaaaaggagc cgcttcgcac gcccaccggc agcattaaac
     2881 agaactcaac catcgagttc gacgggcgat ttgtccactc acgcagtggc gagataatcg
     2941 gcaagaattc ggcggtgtaa ggaggagcgt ttccagaact caaggacctc caggatccag
     3001 aatccagtat ccaaccgcaa tgtgcacaaa acatgaagga gggaagatat atactataca
     3061 catagatata tacttgtatg atgatctagc gagaagaagc caaagccaaa gctgggggaa
     3121 gaaaactgga atatcgatcg attggcacac taagttggtt ttaatttact ttcgtacaca
     3181 gcgtaaatct tactaaatgt cttactataa tacatacgat atcttaaaag catctaaaac
     3241 atagtacatt aagctcgaaa gaccggaaag caaacaagca aaaaataaga ataactccat
     3301 gtcgcttcat tttactttat attttatatc gctgcatctg ctttgtttct ccttagtcag
     3361 attcataaaa attacaaaga aattacaaat aacaaataac gatgaacaaa ggtgggaaga
     3421 gtaaataaaa caagaggaga tgatgagaaa cggacctagc ctaagttata tacatatatt
     3481 taaatatata tgtatgcaag aaagaaatct taaattaatg ccttacaaac aaaaaattac
     3541 atttatttag cagttaaagc gaagagaagg gatttatgca tgtaagccgc aaggaatgag
     3601 aacgatttct ttagtataac taacttaaac atgccataaa taagttttaa cattaagttt
     3661 gccccctgat catcatcccc caccaattcg tagtacttaa aacgctgaac aaaagacttg
     3721 cgagcatttc tttccccaca accatgacat taaatcggat agattagaag aagaaaggac
     3781 ttgaatattt agttgatatc gaaatccttg gtttcctatc gtaattcgta tacttaacca
     3841 ccagaatgtg taatccgcgg acggcaccca atgaaaaatg ctcaatgtac attaatgttg
     3901 acgaaattga aattgaaatg gaatatttga aaatgtttac aaactgctta gcttgactgc
     3961 ttgctaagcg gaagacgttt ccggatccgg ttcatcccac acaagttcaa acacgatgag
     4021 aaaattacga aaatcgaaac taactcaagt taattgctaa gttgtagaag gaaaacggaa
     4081 aacggagaac tacgagattg ccaaacatta actattcatc ttactttcaa cccacttcca
     4141 tcagacaact gcaaatcgct cagttttgtg ttaaaagtat tttcttatgt atgtaaaaat
     4201 taaacaaatt gtagttaaga gacctaaaac gcattaatct aacggatata taaatctaaa
     4261 atatatatat gtatgtacat gtatttaaat ttactcgtaa gttttttttt ctacacgaaa
     4321 caaataatac aaaataaatg aaaaaaaacc aaaacaaaaa gcgaactaca aatatgtaac
     4381 cacgccgatc taaatgtatg tatgttatat ccatatcccc atggaatgcg catttttatt
     4441 tgacccccgc cccgcacaaa tccccgatcc catccgatcc gatccgatcc ttcgctgaga
     4501 tccccaatga gctattgtcg cttctgttgc cagttaagtc aagcgccttg tcagagcttt
     4561 ttacctataa ctatatatac acacacgata ctatacaaag agcctatcga ataacccaca
     4621 aagcgaaccc aaatcgagat tacaggaggc tatatgaatt tgaatttgaa tttggatgca
     4681 attgtttacg gaactgccga ccatgcatat gaaatatgtt tgcaaaaacc gaacggatct
     4741 agccactcga tagctctgtt cggcggcaga gtgtagcttt ttatatgaac taaacaaaat
     4801 tgatgaaaaa ttatacactg aaactgaaac gggggaaaat aaatcgtatt tactgtacta
     4861 taattccaaa