Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156554 4870 bp mRNA linear INV 09-DEC-2024 variant X4, mRNA. ACCESSION XM_017156554 VERSION XM_017156554.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156554.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..4870 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..4870 /gene="Fas2" /note="fasciclin 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108067511" CDS 414..2960 /gene="Fas2" /codon_start=1 /product="fasciclin-2 isoform X4" /protein_id="XP_017012043.2" /db_xref="GeneID:108067511" /translation="MGELRKSLPLNSVGVFLALLLCSCSLIELCQAQSPILEIYPKQE VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGES LALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYV VMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIET GELLERTIRVEVFIQPVIVSLPETLNAVEGKPFAANCTARGKPVPEISWIRDATQLNV ATADRFQVNPQTGLVTISSVTQEDYGTYTCLAKNKAGVVDQKTKLNVLVRPQIYELYN VTGARTKEIAITCRARGRPAPTITFRRWGSEEEFKTGQQFDDPRIILEPNYDQERGES TGTLRIANADRTDDGLYQCIARNSEDKAYKTGHITVEFAPDFSHMKELPPVFSWEQRK ANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKC IATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPPTELGLPILAFSVQ YKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTP RRSAPEEPKPLHQPEQHDTEEPVVVSTYSDHFELRWGVPADNGEPIDKYQIKYCPGVK ISGTWTELEDSCNTVEVVETTSYEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTR GLDVIQVADRQVFSSAAIVGIALGGVLLLLFVVDFLCCITVHMGVMATMCRKAKRSPS EIDDEAKLGRDEKEPLRTPTGSIKQNSTIEFDGRFVHSRSGEIIGKNSAV" misc_feature 522..788 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 573..587 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409404" misc_feature 621..635 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409404" misc_feature 720..734 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409404" misc_feature 762..779 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409404" misc_feature 840..1052 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 891..902 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 927..941 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 993..1007 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1035..1052 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1110..1382 /gene="Fas2" /note="Fourth Ig-like domain from smooth muscle myosin light chain kinase and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_MYLK-like; cd20976" /db_xref="CDD:409568" misc_feature 1110..1121 /gene="Fas2" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409568" misc_feature 1137..1148 /gene="Fas2" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409568" misc_feature 1161..1187 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409568" misc_feature 1203..1217 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409568" misc_feature 1224..1235 /gene="Fas2" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409568" misc_feature 1254..1268 /gene="Fas2" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409568" misc_feature 1278..1295 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409568" misc_feature 1317..1343 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409568" misc_feature 1350..1382 /gene="Fas2" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409568" misc_feature 1413..1697 /gene="Fas2" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 1479..1532 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1593..1607 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1635..1652 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1764..1970 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cd00096" /db_xref="CDD:409353" misc_feature 1764..1778 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1803..1817 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1884..1898 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1926..1943 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1998..2282 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(1998..2000,2199..2201,2244..2246) /gene="Fas2" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(2247..2252,2256..2261) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2343..2630 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2595..2600,2604..2609) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" polyA_site 4870 /gene="Fas2" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcgttcagtt acgtttcgac ggccaacgcg tcgagttgca acttttccgc ctgaaaaata 61 aaaatagcca ctggattgga agacagaact cagttctccc actctctcgc gctctcttca 121 ctgtctgtgt taacggtcgt ggcgcgtcgc gtgcgtgtgt gttagtgtgc cagttaaaca 181 atgagaaatt gattcacaca ccaaaacagc taaacaaaaa caccaaaaga cgaaaagtgt 241 taaccaaaaa aaataaataa tttgtgcaat cgcaaggaac gaaaagagac tacaattttt 301 taaacatttt tttcgtgtgc aaccgtaaac caaaccaaag aagctgaaaa gagagcaatc 361 aatttgcgag cggggaaaac tactactaat actgcaaaaa aaaagcgata aaaatgggtg 421 aactgcgaaa atcgctgccg ctgaattcgg tcggcgtctt tttggcgctg ctcctctgca 481 gctgctcttt aatagaactg tgccaggctc agtcgcccat cctggagatt taccccaaac 541 aagaggtgca gcgcaagcca gttggcaagc ccctgattct cacctgccga cccacagttc 601 ccgagccctc gctggtcgcc gatctgcaat ggaaggataa ccggaacaac accatcctgc 661 ccaagccgaa tggacgcaac cagccgccga tgtacacgga aacgctgccc ggcgaaagtt 721 tggccctgat gattacctcg ctgtcggtgg aaatgggcgg caagtactac tgcaccgcct 781 cctatgcaaa taccgagatc ctcgagaagg gcgtcacaat taaaacttac gtggccatta 841 cctggacaaa tgcccccgag aatcagtatc ccaccttggg ccaggattac gtggtgatgt 901 gtgaggttaa ggccgatccc aatccgacaa tcgactggct gcgcaacgga gatccgatcc 961 gcaccaccaa cgacaagtat gtggtgcaaa cgaacggcct gctgatccgc aatgtccagg 1021 agagtgacga aggcatctac acctgccggg cggcggtgat cgagacgggc gagctgctgg 1081 agcgcaccat tcgcgtggag gtcttcatcc agccggtgat tgtatcgctc ccggagactc 1141 tcaacgcggt cgagggcaaa ccctttgcgg ccaactgcac ggcgaggggc aaaccggtgc 1201 cggagatcag ctggattcgg gatgcgaccc aattgaacgt ggccaccgcc gatcgcttcc 1261 aggtgaatcc ccagacgggt cttgtgacca tcagttcggt tacccaggag gactacggca 1321 cctacacctg cttggcgaag aacaaggccg gcgtggttga ccagaagacc aagctgaatg 1381 tcctggtgcg tccgcagatc tacgaactgt acaatgtgac cggtgccagg accaaggaga 1441 tcgccatcac ctgccgcgcc cgcggacgtc cggcaccgac gatcaccttc cggcgttggg 1501 gcagcgagga ggagttcaag accggccagc agttcgacga tccccgtatt attttggagc 1561 ccaactacga ccaggagcgc ggcgagagca ccggcaccct gcgcatcgcc aatgccgatc 1621 gcaccgacga cggactgtac cagtgcattg cccggaattc ggaggacaag gcctacaaga 1681 ccggacacat caccgtcgag ttcgcccccg acttcagcca catgaaggag ctgccgccgg 1741 tcttctcgtg ggagcagcgc aaggccaatc tcagctgcct ggccatgggc atcccgaatg 1801 ccaccatcga atggcactgg aacggtcgca agatcaagga tctgtacgat accaatctga 1861 agatcgtggg cacgggacct cgcagcgatc tgattgtcca tccggtgacg aggcagtact 1921 actcgggcta caagtgcatt gccacgaata tccacggaac cgccgagcat gatatgcagc 1981 tgaaggaggc acgtgtccct gattttgtgt ccgaggctaa gcccagccaa ctgaccgcca 2041 ccacgatgac cttcgacatc cgaggcccgc ccaccgaact gggtctgccc attctggcgt 2101 tcagtgtgca gtacaaggag gccctcaatc cggactggtc gacggcctac aaccgcagct 2161 ggtcgcccga ttcgccgtac attgtggagg gactgcgacc gcagacggag tacagcttcc 2221 gcttcgccgc ccgcaaccag gtgggactgg gcaactgggg cgtcaaccag cagcagtcga 2281 cgccacgccg ctcggctccc gaggagccca agccactgca tcagcccgag cagcacgaca 2341 ccgaggagcc ggtggtcgtc tcgacctact ccgatcactt cgagctgcgc tggggggtgc 2401 cggccgacaa tggagagccc atcgacaagt accagatcaa atactgtccg ggcgtcaaga 2461 tcagcggcac ctggacggaa ctggaggact cctgcaatac cgtcgaggtg gtggagacca 2521 cctcctacga gatgacacag ctggtgggca acacctatta tcgcatcgaa ctgaaggcgc 2581 acaatgccat cggctattcg tcgccagctt ccatcattat gaagacgaca cgaggactcg 2641 acgttatcca ggtggctgac cgacaggtct tctcctcggc ggccatcgtg ggcatcgcac 2701 tcggcggcgt ccttctgctc ctcttcgtgg tggacttcct gtgctgcatc accgtccaca 2761 tgggcgtcat ggccaccatg tgccgcaagg ccaagcgatc gccctccgag atcgacgacg 2821 aggccaagct gggcagggac gaaaaggagc cgcttcgcac gcccaccggc agcattaaac 2881 agaactcaac catcgagttc gacgggcgat ttgtccactc acgcagtggc gagataatcg 2941 gcaagaattc ggcggtgtaa ggaggagcgt ttccagaact caaggacctc caggatccag 3001 aatccagtat ccaaccgcaa tgtgcacaaa acatgaagga gggaagatat atactataca 3061 catagatata tacttgtatg atgatctagc gagaagaagc caaagccaaa gctgggggaa 3121 gaaaactgga atatcgatcg attggcacac taagttggtt ttaatttact ttcgtacaca 3181 gcgtaaatct tactaaatgt cttactataa tacatacgat atcttaaaag catctaaaac 3241 atagtacatt aagctcgaaa gaccggaaag caaacaagca aaaaataaga ataactccat 3301 gtcgcttcat tttactttat attttatatc gctgcatctg ctttgtttct ccttagtcag 3361 attcataaaa attacaaaga aattacaaat aacaaataac gatgaacaaa ggtgggaaga 3421 gtaaataaaa caagaggaga tgatgagaaa cggacctagc ctaagttata tacatatatt 3481 taaatatata tgtatgcaag aaagaaatct taaattaatg ccttacaaac aaaaaattac 3541 atttatttag cagttaaagc gaagagaagg gatttatgca tgtaagccgc aaggaatgag 3601 aacgatttct ttagtataac taacttaaac atgccataaa taagttttaa cattaagttt 3661 gccccctgat catcatcccc caccaattcg tagtacttaa aacgctgaac aaaagacttg 3721 cgagcatttc tttccccaca accatgacat taaatcggat agattagaag aagaaaggac 3781 ttgaatattt agttgatatc gaaatccttg gtttcctatc gtaattcgta tacttaacca 3841 ccagaatgtg taatccgcgg acggcaccca atgaaaaatg ctcaatgtac attaatgttg 3901 acgaaattga aattgaaatg gaatatttga aaatgtttac aaactgctta gcttgactgc 3961 ttgctaagcg gaagacgttt ccggatccgg ttcatcccac acaagttcaa acacgatgag 4021 aaaattacga aaatcgaaac taactcaagt taattgctaa gttgtagaag gaaaacggaa 4081 aacggagaac tacgagattg ccaaacatta actattcatc ttactttcaa cccacttcca 4141 tcagacaact gcaaatcgct cagttttgtg ttaaaagtat tttcttatgt atgtaaaaat 4201 taaacaaatt gtagttaaga gacctaaaac gcattaatct aacggatata taaatctaaa 4261 atatatatat gtatgtacat gtatttaaat ttactcgtaa gttttttttt ctacacgaaa 4321 caaataatac aaaataaatg aaaaaaaacc aaaacaaaaa gcgaactaca aatatgtaac 4381 cacgccgatc taaatgtatg tatgttatat ccatatcccc atggaatgcg catttttatt 4441 tgacccccgc cccgcacaaa tccccgatcc catccgatcc gatccgatcc ttcgctgaga 4501 tccccaatga gctattgtcg cttctgttgc cagttaagtc aagcgccttg tcagagcttt 4561 ttacctataa ctatatatac acacacgata ctatacaaag agcctatcga ataacccaca 4621 aagcgaaccc aaatcgagat tacaggaggc tatatgaatt tgaatttgaa tttggatgca 4681 attgtttacg gaactgccga ccatgcatat gaaatatgtt tgcaaaaacc gaacggatct 4741 agccactcga tagctctgtt cggcggcaga gtgtagcttt ttatatgaac taaacaaaat 4801 tgatgaaaaa ttatacactg aaactgaaac gggggaaaat aaatcgtatt tactgtacta 4861 taattccaaa