Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156552 4915 bp mRNA linear INV 09-DEC-2024 variant X3, mRNA. ACCESSION XM_017156552 VERSION XM_017156552.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156552.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..4915 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..4915 /gene="Fas2" /note="fasciclin 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108067511" CDS 414..3005 /gene="Fas2" /codon_start=1 /product="fasciclin-2 isoform X3" /protein_id="XP_017012041.2" /db_xref="GeneID:108067511" /translation="MGELRKSLPLNSVGVFLALLLCSCSLIELCQAQSPILEIYPKQE VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNYDPLYDSKGNRKKENG RNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWT NAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQE SDEGIYTCRAAVIETGELLERTIRVEVFIQPVIVSLPETLNAVEGKPFAANCTARGKP VPEISWIRDATQLNVATADRFQVNPQTGLVTISSVTQEDYGTYTCLAKNKAGVVDQKT KLNVLVRPQIYELYNVTGARTKEIAITCRARGRPAPTITFRRWGSEEEFKTGQQFDDP RIILEPNYDQERGESTGTLRIANADRTDDGLYQCIARNSEDKAYKTGHITVEFAPDFS HMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDL IVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRG PPTELGLPILAFSVQYKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQ VGLGNWGVNQQQSTPRRSAPEEPKPLHQPEQHDTEEPVVVSTYSDHFELRWGVPADNG EPIDKYQIKYCPGVKISGTWTELEDSCNTVEVVETTSYEMTQLVGNTYYRIELKAHNA IGYSSPASIIMKTTRGLDVIQVADRQVFSSAAIVGIALGGVLLLLFVVDFLCCITVHM GVMATMCRKAKRSPSEIDDEAKLGRDEKEPLRTPTGSIKQNSTIEFDGRFVHSRSGEI IGKNSAV" misc_feature 522..833 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 573..587 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409404" misc_feature 621..635 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409404" misc_feature 765..779 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409404" misc_feature 807..824 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409404" misc_feature 885..1097 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cl11960" /db_xref="CDD:472250" misc_feature 936..947 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409570" misc_feature 972..986 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409570" misc_feature 1038..1052 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409570" misc_feature 1080..1097 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409570" misc_feature 1155..1427 /gene="Fas2" /note="Fourth Ig-like domain from smooth muscle myosin light chain kinase and similar domains; a member of the I-set of IgSF domains; Region: IgI_4_MYLK-like; cd20976" /db_xref="CDD:409568" misc_feature 1155..1166 /gene="Fas2" /note="Ig strand A [structural motif]; Region: Ig strand A" /db_xref="CDD:409568" misc_feature 1182..1193 /gene="Fas2" /note="Ig strand A' [structural motif]; Region: Ig strand A'" /db_xref="CDD:409568" misc_feature 1206..1232 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409568" misc_feature 1248..1262 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409568" misc_feature 1269..1280 /gene="Fas2" /note="Ig strand C' [structural motif]; Region: Ig strand C'" /db_xref="CDD:409568" misc_feature 1299..1313 /gene="Fas2" /note="Ig strand D [structural motif]; Region: Ig strand D" /db_xref="CDD:409568" misc_feature 1323..1340 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409568" misc_feature 1362..1388 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409568" misc_feature 1395..1427 /gene="Fas2" /note="Ig strand G [structural motif]; Region: Ig strand G" /db_xref="CDD:409568" misc_feature 1458..1742 /gene="Fas2" /note="Immunoglobulin like; Region: IG_like; smart00410" /db_xref="CDD:214653" misc_feature 1524..1577 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1638..1652 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1680..1697 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 1809..2015 /gene="Fas2" /note="Immunoglobulin domain; Region: Ig; cd00096" /db_xref="CDD:409353" misc_feature 1809..1823 /gene="Fas2" /note="Ig strand B [structural motif]; Region: Ig strand B" /db_xref="CDD:409353" misc_feature 1848..1862 /gene="Fas2" /note="Ig strand C [structural motif]; Region: Ig strand C" /db_xref="CDD:409353" misc_feature 1929..1943 /gene="Fas2" /note="Ig strand E [structural motif]; Region: Ig strand E" /db_xref="CDD:409353" misc_feature 1971..1988 /gene="Fas2" /note="Ig strand F [structural motif]; Region: Ig strand F" /db_xref="CDD:409353" misc_feature 2043..2327 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2043..2045,2244..2246,2289..2291) /gene="Fas2" /note="Interdomain contacts [active]" /db_xref="CDD:238020" misc_feature order(2292..2297,2301..2306) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" misc_feature 2388..2675 /gene="Fas2" /note="Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063" /db_xref="CDD:238020" misc_feature order(2640..2645,2649..2654) /gene="Fas2" /note="Cytokine receptor motif [active]" /db_xref="CDD:238020" polyA_site 4915 /gene="Fas2" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcgttcagtt acgtttcgac ggccaacgcg tcgagttgca acttttccgc ctgaaaaata 61 aaaatagcca ctggattgga agacagaact cagttctccc actctctcgc gctctcttca 121 ctgtctgtgt taacggtcgt ggcgcgtcgc gtgcgtgtgt gttagtgtgc cagttaaaca 181 atgagaaatt gattcacaca ccaaaacagc taaacaaaaa caccaaaaga cgaaaagtgt 241 taaccaaaaa aaataaataa tttgtgcaat cgcaaggaac gaaaagagac tacaattttt 301 taaacatttt tttcgtgtgc aaccgtaaac caaaccaaag aagctgaaaa gagagcaatc 361 aatttgcgag cggggaaaac tactactaat actgcaaaaa aaaagcgata aaaatgggtg 421 aactgcgaaa atcgctgccg ctgaattcgg tcggcgtctt tttggcgctg ctcctctgca 481 gctgctcttt aatagaactg tgccaggctc agtcgcccat cctggagatt taccccaaac 541 aagaggtgca gcgcaagcca gttggcaagc ccctgattct cacctgccga cccacagttc 601 ccgagccctc gctggtcgcc gatctgcaat ggaaggataa ccggaacaac accatcctgc 661 ccaagccgaa ttacgatcca ctgtatgatt ccaagggcaa tagaaagaaa gagaatggac 721 gcaaccagcc gccgatgtac acggaaacgc tgcccggcga aagtttggcc ctgatgatta 781 cctcgctgtc ggtggaaatg ggcggcaagt actactgcac cgcctcctat gcaaataccg 841 agatcctcga gaagggcgtc acaattaaaa cttacgtggc cattacctgg acaaatgccc 901 ccgagaatca gtatcccacc ttgggccagg attacgtggt gatgtgtgag gttaaggccg 961 atcccaatcc gacaatcgac tggctgcgca acggagatcc gatccgcacc accaacgaca 1021 agtatgtggt gcaaacgaac ggcctgctga tccgcaatgt ccaggagagt gacgaaggca 1081 tctacacctg ccgggcggcg gtgatcgaga cgggcgagct gctggagcgc accattcgcg 1141 tggaggtctt catccagccg gtgattgtat cgctcccgga gactctcaac gcggtcgagg 1201 gcaaaccctt tgcggccaac tgcacggcga ggggcaaacc ggtgccggag atcagctgga 1261 ttcgggatgc gacccaattg aacgtggcca ccgccgatcg cttccaggtg aatccccaga 1321 cgggtcttgt gaccatcagt tcggttaccc aggaggacta cggcacctac acctgcttgg 1381 cgaagaacaa ggccggcgtg gttgaccaga agaccaagct gaatgtcctg gtgcgtccgc 1441 agatctacga actgtacaat gtgaccggtg ccaggaccaa ggagatcgcc atcacctgcc 1501 gcgcccgcgg acgtccggca ccgacgatca ccttccggcg ttggggcagc gaggaggagt 1561 tcaagaccgg ccagcagttc gacgatcccc gtattatttt ggagcccaac tacgaccagg 1621 agcgcggcga gagcaccggc accctgcgca tcgccaatgc cgatcgcacc gacgacggac 1681 tgtaccagtg cattgcccgg aattcggagg acaaggccta caagaccgga cacatcaccg 1741 tcgagttcgc ccccgacttc agccacatga aggagctgcc gccggtcttc tcgtgggagc 1801 agcgcaaggc caatctcagc tgcctggcca tgggcatccc gaatgccacc atcgaatggc 1861 actggaacgg tcgcaagatc aaggatctgt acgataccaa tctgaagatc gtgggcacgg 1921 gacctcgcag cgatctgatt gtccatccgg tgacgaggca gtactactcg ggctacaagt 1981 gcattgccac gaatatccac ggaaccgccg agcatgatat gcagctgaag gaggcacgtg 2041 tccctgattt tgtgtccgag gctaagccca gccaactgac cgccaccacg atgaccttcg 2101 acatccgagg cccgcccacc gaactgggtc tgcccattct ggcgttcagt gtgcagtaca 2161 aggaggccct caatccggac tggtcgacgg cctacaaccg cagctggtcg cccgattcgc 2221 cgtacattgt ggagggactg cgaccgcaga cggagtacag cttccgcttc gccgcccgca 2281 accaggtggg actgggcaac tggggcgtca accagcagca gtcgacgcca cgccgctcgg 2341 ctcccgagga gcccaagcca ctgcatcagc ccgagcagca cgacaccgag gagccggtgg 2401 tcgtctcgac ctactccgat cacttcgagc tgcgctgggg ggtgccggcc gacaatggag 2461 agcccatcga caagtaccag atcaaatact gtccgggcgt caagatcagc ggcacctgga 2521 cggaactgga ggactcctgc aataccgtcg aggtggtgga gaccacctcc tacgagatga 2581 cacagctggt gggcaacacc tattatcgca tcgaactgaa ggcgcacaat gccatcggct 2641 attcgtcgcc agcttccatc attatgaaga cgacacgagg actcgacgtt atccaggtgg 2701 ctgaccgaca ggtcttctcc tcggcggcca tcgtgggcat cgcactcggc ggcgtccttc 2761 tgctcctctt cgtggtggac ttcctgtgct gcatcaccgt ccacatgggc gtcatggcca 2821 ccatgtgccg caaggccaag cgatcgccct ccgagatcga cgacgaggcc aagctgggca 2881 gggacgaaaa ggagccgctt cgcacgccca ccggcagcat taaacagaac tcaaccatcg 2941 agttcgacgg gcgatttgtc cactcacgca gtggcgagat aatcggcaag aattcggcgg 3001 tgtaaggagg agcgtttcca gaactcaagg acctccagga tccagaatcc agtatccaac 3061 cgcaatgtgc acaaaacatg aaggagggaa gatatatact atacacatag atatatactt 3121 gtatgatgat ctagcgagaa gaagccaaag ccaaagctgg gggaagaaaa ctggaatatc 3181 gatcgattgg cacactaagt tggttttaat ttactttcgt acacagcgta aatcttacta 3241 aatgtcttac tataatacat acgatatctt aaaagcatct aaaacatagt acattaagct 3301 cgaaagaccg gaaagcaaac aagcaaaaaa taagaataac tccatgtcgc ttcattttac 3361 tttatatttt atatcgctgc atctgctttg tttctcctta gtcagattca taaaaattac 3421 aaagaaatta caaataacaa ataacgatga acaaaggtgg gaagagtaaa taaaacaaga 3481 ggagatgatg agaaacggac ctagcctaag ttatatacat atatttaaat atatatgtat 3541 gcaagaaaga aatcttaaat taatgcctta caaacaaaaa attacattta tttagcagtt 3601 aaagcgaaga gaagggattt atgcatgtaa gccgcaagga atgagaacga tttctttagt 3661 ataactaact taaacatgcc ataaataagt tttaacatta agtttgcccc ctgatcatca 3721 tcccccacca attcgtagta cttaaaacgc tgaacaaaag acttgcgagc atttctttcc 3781 ccacaaccat gacattaaat cggatagatt agaagaagaa aggacttgaa tatttagttg 3841 atatcgaaat ccttggtttc ctatcgtaat tcgtatactt aaccaccaga atgtgtaatc 3901 cgcggacggc acccaatgaa aaatgctcaa tgtacattaa tgttgacgaa attgaaattg 3961 aaatggaata tttgaaaatg tttacaaact gcttagcttg actgcttgct aagcggaaga 4021 cgtttccgga tccggttcat cccacacaag ttcaaacacg atgagaaaat tacgaaaatc 4081 gaaactaact caagttaatt gctaagttgt agaaggaaaa cggaaaacgg agaactacga 4141 gattgccaaa cattaactat tcatcttact ttcaacccac ttccatcaga caactgcaaa 4201 tcgctcagtt ttgtgttaaa agtattttct tatgtatgta aaaattaaac aaattgtagt 4261 taagagacct aaaacgcatt aatctaacgg atatataaat ctaaaatata tatatgtatg 4321 tacatgtatt taaatttact cgtaagtttt tttttctaca cgaaacaaat aatacaaaat 4381 aaatgaaaaa aaaccaaaac aaaaagcgaa ctacaaatat gtaaccacgc cgatctaaat 4441 gtatgtatgt tatatccata tccccatgga atgcgcattt ttatttgacc cccgccccgc 4501 acaaatcccc gatcccatcc gatccgatcc gatccttcgc tgagatcccc aatgagctat 4561 tgtcgcttct gttgccagtt aagtcaagcg ccttgtcaga gctttttacc tataactata 4621 tatacacaca cgatactata caaagagcct atcgaataac ccacaaagcg aacccaaatc 4681 gagattacag gaggctatat gaatttgaat ttgaatttgg atgcaattgt ttacggaact 4741 gccgaccatg catatgaaat atgtttgcaa aaaccgaacg gatctagcca ctcgatagct 4801 ctgttcggcg gcagagtgta gctttttata tgaactaaac aaaattgatg aaaaattata 4861 cactgaaact gaaacggggg aaaataaatc gtatttactg tactataatt ccaaa