Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii fasciclin 2 (Fas2), transcript


LOCUS       XM_017156549            5002 bp    mRNA    linear   INV 09-DEC-2024
            variant X1, mRNA.
ACCESSION   XM_017156549
VERSION     XM_017156549.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156549.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5002
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..5002
                     /gene="Fas2"
                     /note="fasciclin 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108067511"
     CDS             414..3092
                     /gene="Fas2"
                     /codon_start=1
                     /product="fasciclin-2 isoform X1"
                     /protein_id="XP_017012038.2"
                     /db_xref="GeneID:108067511"
                     /translation="MGELRKSLPLNSVGVFLALLLCSCSLIELCQAQSPILEIYPKQE
                     VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNYDPLYDSKGNRKKENG
                     RNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWT
                     NAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQE
                     SDEGIYTCRAAVIETGELLERTIRVEVFIQPVIVSLPETLNAVEGKPFAANCTARGKP
                     VPEISWIRDATQLNVATADRFQVNPQTGLVTISSVTQEDYGTYTCLAKNKAGVVDQKT
                     KLNVLVRPQIYELYNVTGARTKEIAITCRARGRPAPTITFRRWGSEEEFKTGQQFDDP
                     RIILEPNYDQERGESTGTLRIANADRTDDGLYQCIARNSEDKAYKTGHITVEFAPDFS
                     HMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDL
                     IVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRG
                     PPTELGLPILAFSVQYKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQ
                     VGLGNWGVNQQQSTPRRSAPEEPKPLHQPEQHDTEEPVVVSTYSDHFELRWGVPADNG
                     EPIDKYQIKYCPGVKISGTWTELEDSCNTVEVVETTSYEMTQLVGNTYYRIELKAHNA
                     IGYSSPASIIMKTTRGLDVIQVADRQVFSSAAIVGIALGGVLLLLFVVDFLCCITVHM
                     GVMATMCRKAKRSPSEIDDEAKLGSGQLVKEPPPSPLPLPPPVKLGGSPMTSPLDEKE
                     PLRTPTGSIKQNSTIEFDGRFVHSRSGEIIGKNSAV"
     misc_feature    522..833
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    573..587
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409404"
     misc_feature    621..635
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409404"
     misc_feature    765..779
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409404"
     misc_feature    807..824
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409404"
     misc_feature    885..1097
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    936..947
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    972..986
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    1038..1052
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    1080..1097
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    1155..1427
                     /gene="Fas2"
                     /note="Fourth Ig-like domain from smooth muscle myosin
                     light chain kinase and similar domains; a member of the
                     I-set of IgSF domains; Region: IgI_4_MYLK-like; cd20976"
                     /db_xref="CDD:409568"
     misc_feature    1155..1166
                     /gene="Fas2"
                     /note="Ig strand A [structural motif]; Region: Ig strand
                     A"
                     /db_xref="CDD:409568"
     misc_feature    1182..1193
                     /gene="Fas2"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409568"
     misc_feature    1206..1232
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409568"
     misc_feature    1248..1262
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409568"
     misc_feature    1269..1280
                     /gene="Fas2"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409568"
     misc_feature    1299..1313
                     /gene="Fas2"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409568"
     misc_feature    1323..1340
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409568"
     misc_feature    1362..1388
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409568"
     misc_feature    1395..1427
                     /gene="Fas2"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409568"
     misc_feature    1458..1742
                     /gene="Fas2"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    1524..1577
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1638..1652
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1680..1697
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    1809..2015
                     /gene="Fas2"
                     /note="Immunoglobulin domain; Region: Ig; cd00096"
                     /db_xref="CDD:409353"
     misc_feature    1809..1823
                     /gene="Fas2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    1848..1862
                     /gene="Fas2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    1929..1943
                     /gene="Fas2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    1971..1988
                     /gene="Fas2"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    2043..2327
                     /gene="Fas2"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(2043..2045,2244..2246,2289..2291)
                     /gene="Fas2"
                     /note="Interdomain contacts [active]"
                     /db_xref="CDD:238020"
     misc_feature    order(2292..2297,2301..2306)
                     /gene="Fas2"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     misc_feature    2388..2675
                     /gene="Fas2"
                     /note="Fibronectin type 3 domain; One of three types of
                     internal repeats found in the plasma protein fibronectin.
                     Its tenth fibronectin type III repeat contains an RGD cell
                     recognition sequence in a flexible loop between 2 strands.
                     Approximately 2% of all...; Region: FN3; cd00063"
                     /db_xref="CDD:238020"
     misc_feature    order(2640..2645,2649..2654)
                     /gene="Fas2"
                     /note="Cytokine receptor motif [active]"
                     /db_xref="CDD:238020"
     polyA_site      5002
                     /gene="Fas2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcgttcagtt acgtttcgac ggccaacgcg tcgagttgca acttttccgc ctgaaaaata
       61 aaaatagcca ctggattgga agacagaact cagttctccc actctctcgc gctctcttca
      121 ctgtctgtgt taacggtcgt ggcgcgtcgc gtgcgtgtgt gttagtgtgc cagttaaaca
      181 atgagaaatt gattcacaca ccaaaacagc taaacaaaaa caccaaaaga cgaaaagtgt
      241 taaccaaaaa aaataaataa tttgtgcaat cgcaaggaac gaaaagagac tacaattttt
      301 taaacatttt tttcgtgtgc aaccgtaaac caaaccaaag aagctgaaaa gagagcaatc
      361 aatttgcgag cggggaaaac tactactaat actgcaaaaa aaaagcgata aaaatgggtg
      421 aactgcgaaa atcgctgccg ctgaattcgg tcggcgtctt tttggcgctg ctcctctgca
      481 gctgctcttt aatagaactg tgccaggctc agtcgcccat cctggagatt taccccaaac
      541 aagaggtgca gcgcaagcca gttggcaagc ccctgattct cacctgccga cccacagttc
      601 ccgagccctc gctggtcgcc gatctgcaat ggaaggataa ccggaacaac accatcctgc
      661 ccaagccgaa ttacgatcca ctgtatgatt ccaagggcaa tagaaagaaa gagaatggac
      721 gcaaccagcc gccgatgtac acggaaacgc tgcccggcga aagtttggcc ctgatgatta
      781 cctcgctgtc ggtggaaatg ggcggcaagt actactgcac cgcctcctat gcaaataccg
      841 agatcctcga gaagggcgtc acaattaaaa cttacgtggc cattacctgg acaaatgccc
      901 ccgagaatca gtatcccacc ttgggccagg attacgtggt gatgtgtgag gttaaggccg
      961 atcccaatcc gacaatcgac tggctgcgca acggagatcc gatccgcacc accaacgaca
     1021 agtatgtggt gcaaacgaac ggcctgctga tccgcaatgt ccaggagagt gacgaaggca
     1081 tctacacctg ccgggcggcg gtgatcgaga cgggcgagct gctggagcgc accattcgcg
     1141 tggaggtctt catccagccg gtgattgtat cgctcccgga gactctcaac gcggtcgagg
     1201 gcaaaccctt tgcggccaac tgcacggcga ggggcaaacc ggtgccggag atcagctgga
     1261 ttcgggatgc gacccaattg aacgtggcca ccgccgatcg cttccaggtg aatccccaga
     1321 cgggtcttgt gaccatcagt tcggttaccc aggaggacta cggcacctac acctgcttgg
     1381 cgaagaacaa ggccggcgtg gttgaccaga agaccaagct gaatgtcctg gtgcgtccgc
     1441 agatctacga actgtacaat gtgaccggtg ccaggaccaa ggagatcgcc atcacctgcc
     1501 gcgcccgcgg acgtccggca ccgacgatca ccttccggcg ttggggcagc gaggaggagt
     1561 tcaagaccgg ccagcagttc gacgatcccc gtattatttt ggagcccaac tacgaccagg
     1621 agcgcggcga gagcaccggc accctgcgca tcgccaatgc cgatcgcacc gacgacggac
     1681 tgtaccagtg cattgcccgg aattcggagg acaaggccta caagaccgga cacatcaccg
     1741 tcgagttcgc ccccgacttc agccacatga aggagctgcc gccggtcttc tcgtgggagc
     1801 agcgcaaggc caatctcagc tgcctggcca tgggcatccc gaatgccacc atcgaatggc
     1861 actggaacgg tcgcaagatc aaggatctgt acgataccaa tctgaagatc gtgggcacgg
     1921 gacctcgcag cgatctgatt gtccatccgg tgacgaggca gtactactcg ggctacaagt
     1981 gcattgccac gaatatccac ggaaccgccg agcatgatat gcagctgaag gaggcacgtg
     2041 tccctgattt tgtgtccgag gctaagccca gccaactgac cgccaccacg atgaccttcg
     2101 acatccgagg cccgcccacc gaactgggtc tgcccattct ggcgttcagt gtgcagtaca
     2161 aggaggccct caatccggac tggtcgacgg cctacaaccg cagctggtcg cccgattcgc
     2221 cgtacattgt ggagggactg cgaccgcaga cggagtacag cttccgcttc gccgcccgca
     2281 accaggtggg actgggcaac tggggcgtca accagcagca gtcgacgcca cgccgctcgg
     2341 ctcccgagga gcccaagcca ctgcatcagc ccgagcagca cgacaccgag gagccggtgg
     2401 tcgtctcgac ctactccgat cacttcgagc tgcgctgggg ggtgccggcc gacaatggag
     2461 agcccatcga caagtaccag atcaaatact gtccgggcgt caagatcagc ggcacctgga
     2521 cggaactgga ggactcctgc aataccgtcg aggtggtgga gaccacctcc tacgagatga
     2581 cacagctggt gggcaacacc tattatcgca tcgaactgaa ggcgcacaat gccatcggct
     2641 attcgtcgcc agcttccatc attatgaaga cgacacgagg actcgacgtt atccaggtgg
     2701 ctgaccgaca ggtcttctcc tcggcggcca tcgtgggcat cgcactcggc ggcgtccttc
     2761 tgctcctctt cgtggtggac ttcctgtgct gcatcaccgt ccacatgggc gtcatggcca
     2821 ccatgtgccg caaggccaag cgatcgccct ccgagatcga cgacgaggcc aagctgggca
     2881 gtggccagct ggtaaaggag ccgccaccat cgccgttgcc actgccgccg cccgtcaaac
     2941 tgggcggttc gcccatgaca tcgccattgg acgaaaagga gccgcttcgc acgcccaccg
     3001 gcagcattaa acagaactca accatcgagt tcgacgggcg atttgtccac tcacgcagtg
     3061 gcgagataat cggcaagaat tcggcggtgt aaggaggagc gtttccagaa ctcaaggacc
     3121 tccaggatcc agaatccagt atccaaccgc aatgtgcaca aaacatgaag gagggaagat
     3181 atatactata cacatagata tatacttgta tgatgatcta gcgagaagaa gccaaagcca
     3241 aagctggggg aagaaaactg gaatatcgat cgattggcac actaagttgg ttttaattta
     3301 ctttcgtaca cagcgtaaat cttactaaat gtcttactat aatacatacg atatcttaaa
     3361 agcatctaaa acatagtaca ttaagctcga aagaccggaa agcaaacaag caaaaaataa
     3421 gaataactcc atgtcgcttc attttacttt atattttata tcgctgcatc tgctttgttt
     3481 ctccttagtc agattcataa aaattacaaa gaaattacaa ataacaaata acgatgaaca
     3541 aaggtgggaa gagtaaataa aacaagagga gatgatgaga aacggaccta gcctaagtta
     3601 tatacatata tttaaatata tatgtatgca agaaagaaat cttaaattaa tgccttacaa
     3661 acaaaaaatt acatttattt agcagttaaa gcgaagagaa gggatttatg catgtaagcc
     3721 gcaaggaatg agaacgattt ctttagtata actaacttaa acatgccata aataagtttt
     3781 aacattaagt ttgccccctg atcatcatcc cccaccaatt cgtagtactt aaaacgctga
     3841 acaaaagact tgcgagcatt tctttcccca caaccatgac attaaatcgg atagattaga
     3901 agaagaaagg acttgaatat ttagttgata tcgaaatcct tggtttccta tcgtaattcg
     3961 tatacttaac caccagaatg tgtaatccgc ggacggcacc caatgaaaaa tgctcaatgt
     4021 acattaatgt tgacgaaatt gaaattgaaa tggaatattt gaaaatgttt acaaactgct
     4081 tagcttgact gcttgctaag cggaagacgt ttccggatcc ggttcatccc acacaagttc
     4141 aaacacgatg agaaaattac gaaaatcgaa actaactcaa gttaattgct aagttgtaga
     4201 aggaaaacgg aaaacggaga actacgagat tgccaaacat taactattca tcttactttc
     4261 aacccacttc catcagacaa ctgcaaatcg ctcagttttg tgttaaaagt attttcttat
     4321 gtatgtaaaa attaaacaaa ttgtagttaa gagacctaaa acgcattaat ctaacggata
     4381 tataaatcta aaatatatat atgtatgtac atgtatttaa atttactcgt aagttttttt
     4441 ttctacacga aacaaataat acaaaataaa tgaaaaaaaa ccaaaacaaa aagcgaacta
     4501 caaatatgta accacgccga tctaaatgta tgtatgttat atccatatcc ccatggaatg
     4561 cgcattttta tttgaccccc gccccgcaca aatccccgat cccatccgat ccgatccgat
     4621 ccttcgctga gatccccaat gagctattgt cgcttctgtt gccagttaag tcaagcgcct
     4681 tgtcagagct ttttacctat aactatatat acacacacga tactatacaa agagcctatc
     4741 gaataaccca caaagcgaac ccaaatcgag attacaggag gctatatgaa tttgaatttg
     4801 aatttggatg caattgttta cggaactgcc gaccatgcat atgaaatatg tttgcaaaaa
     4861 ccgaacggat ctagccactc gatagctctg ttcggcggca gagtgtagct ttttatatga
     4921 actaaacaaa attgatgaaa aattatacac tgaaactgaa acgggggaaa ataaatcgta
     4981 tttactgtac tataattcca aa