Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017156543             994 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108067506), mRNA.
ACCESSION   XM_017156543
VERSION     XM_017156543.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156543.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..994
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..994
                     /gene="LOC108067506"
                     /note="uncharacterized LOC108067506; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108067506"
     CDS             14..754
                     /gene="LOC108067506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017012032.3"
                     /db_xref="GeneID:108067506"
                     /translation="MSSHPIRAYTHIQLRPQDPLKFPDIEYTKKMAQQPGEKTKPNPT
                     DPKSRKLKFAGCCHLKDEALARLYRIDRLTDEELASVGLQRSSLIDDYRHLHEMSLMR
                     KWVNGVRPGRTAQTQKSSRSKLPQLRVPEFKPAKLYKFQLLNQLVKVMSFEKEPESVF
                     NEQQFEFDADYQEDEEVQRMPPKERQRRRFESFCDHLDNMFISGDRNMAIDLVVDALI
                     RLNRRRKQLPPTGPANPSRLLPVPRREY"
     polyA_site      994
                     /gene="LOC108067506"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agttagatct ccaatgagca gtcacccgat tcgagcatac acacacatcc agctccgtcc
       61 acaagatccc ctgaaattcc cagacataga atatacgaag aaaatggccc agcagccggg
      121 tgagaagacc aagccgaatc ccaccgatcc caagtcgcgg aaactcaagt tcgccggctg
      181 ttgccatctg aaggacgagg ccctggcgcg cctgtacagg atcgaccggc tgaccgacga
      241 ggagctggcc tccgtgggcc tgcagcgcag ctccctgatc gacgactatc gccatctgca
      301 cgagatgtcg ctgatgagga agtgggtgaa cggagtgcgt ccaggtcgca ctgctcagac
      361 gcagaagagc agccgctcca agctgcccca gttgcgcgtc ccggagttca agcccgccaa
      421 gctgtacaaa ttccagctgc tcaaccagct ggtcaaggtg atgagcttcg agaaggaacc
      481 ggagtccgtc ttcaacgagc agcagttcga gttcgatgca gactaccagg aggacgagga
      541 ggtccagcgg atgccgccca aggagcgcca gcgccgccgc ttcgagtcct tctgcgatca
      601 cctggacaac atgttcatca gcggcgaccg caacatggcc atcgatctcg tcgtggacgc
      661 cctcatccgt ctgaacaggc gccgcaagca gctgcccccc actgggcccg ccaatcccag
      721 tcgcctcctg ccagttccca ggcgggagta ctaactgtag ggcatctgga gccattatcc
      781 gtagtccgag ttccatagtc cgtagtccat agtccgtagt cccacaccaa aatcattcca
      841 aagcgtgcat tagtagtaaa aagaaaagat ggaaaatcga aagttctctt ttttgttaat
      901 ttttatttcg attctccact gaaatacact tctctccagt atattatata ttttaaacac
      961 attttaaatt aaatttcgat ttcccattca aaaa