Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156314 511 bp mRNA linear INV 09-DEC-2024 membrane translocase subunit Tim13 (LOC108067341), mRNA. ACCESSION XM_017156314 VERSION XM_017156314.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156314.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..511 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..511 /gene="LOC108067341" /note="mitochondrial import inner membrane translocase subunit Tim13; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108067341" CDS 109..396 /gene="LOC108067341" /codon_start=1 /product="mitochondrial import inner membrane translocase subunit Tim13" /protein_id="XP_017011803.1" /db_xref="GeneID:108067341" /translation="MAPNHYDLERIRQQIVLANIQELIQKMTRRCFNACIALPGLELR STERDCLSSCMDRFMDSVQVVSCQYFRRRRRQQQLRLNRLASESSASSASK" misc_feature 139..306 /gene="LOC108067341" /note="Tim10/DDP family zinc finger; Region: zf-Tim10_DDP; pfam02953" /db_xref="CDD:460764" polyA_site 511 /gene="LOC108067341" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggccaatcca gtccattcat gtccggcccg tgtccaaatt aaaaggtgct tacccagctc 61 acaattccga ctccattccg actccattcc gaccattagt aatcccgaat ggcgcccaac 121 cattacgacc tcgagcggat tcgccagcag atcgtgctgg ccaacatcca ggagctcatc 181 cagaagatga cgcgtcgctg cttcaacgcg tgcatcgctc ttcccggcct ggagttgcgc 241 tccacggaac gcgactgcct gtccagctgc atggatcggt tcatggactc ggttcaggtg 301 gtctcgtgcc agtatttcag gcgccggcgc cgccagcagc agctccgttt gaaccgcttg 361 gctagtgaat cctccgcatc cagtgcttcc aagtgagggt tgatttccca cagaggaata 421 tgtagaccga ttgcagatag cctgatgtgc tgtgtctaac ccccagatct acggtttcca 481 actggaaccc aaaagggtta aggtcacttg a