Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial import inner


LOCUS       XM_017156314             511 bp    mRNA    linear   INV 09-DEC-2024
            membrane translocase subunit Tim13 (LOC108067341), mRNA.
ACCESSION   XM_017156314
VERSION     XM_017156314.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156314.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..511
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..511
                     /gene="LOC108067341"
                     /note="mitochondrial import inner membrane translocase
                     subunit Tim13; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108067341"
     CDS             109..396
                     /gene="LOC108067341"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit Tim13"
                     /protein_id="XP_017011803.1"
                     /db_xref="GeneID:108067341"
                     /translation="MAPNHYDLERIRQQIVLANIQELIQKMTRRCFNACIALPGLELR
                     STERDCLSSCMDRFMDSVQVVSCQYFRRRRRQQQLRLNRLASESSASSASK"
     misc_feature    139..306
                     /gene="LOC108067341"
                     /note="Tim10/DDP family zinc finger; Region: zf-Tim10_DDP;
                     pfam02953"
                     /db_xref="CDD:460764"
     polyA_site      511
                     /gene="LOC108067341"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggccaatcca gtccattcat gtccggcccg tgtccaaatt aaaaggtgct tacccagctc
       61 acaattccga ctccattccg actccattcc gaccattagt aatcccgaat ggcgcccaac
      121 cattacgacc tcgagcggat tcgccagcag atcgtgctgg ccaacatcca ggagctcatc
      181 cagaagatga cgcgtcgctg cttcaacgcg tgcatcgctc ttcccggcct ggagttgcgc
      241 tccacggaac gcgactgcct gtccagctgc atggatcggt tcatggactc ggttcaggtg
      301 gtctcgtgcc agtatttcag gcgccggcgc cgccagcagc agctccgttt gaaccgcttg
      361 gctagtgaat cctccgcatc cagtgcttcc aagtgagggt tgatttccca cagaggaata
      421 tgtagaccga ttgcagatag cctgatgtgc tgtgtctaac ccccagatct acggtttcca
      481 actggaaccc aaaagggtta aggtcacttg a