Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156097 675 bp mRNA linear INV 09-DEC-2024 (LOC108067188), mRNA. ACCESSION XM_017156097 VERSION XM_017156097.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156097.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 19% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..675 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..675 /gene="LOC108067188" /note="uncharacterized LOC108067188; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108067188" CDS 19..675 /gene="LOC108067188" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017011586.3" /db_xref="GeneID:108067188" /translation="MFRVIQLYILILVCCFALMRTQHQQQTGNQFQPSWLYSMPWRPL ILPTANPLPPMAGIAQLSPGYTGPQTFPPVPQDQQQFNIPQQQLRALALQQYPQPYQP VLVGLFTPQLQPLPLAAPPPAGHFGLPFRSSPFAGYTDDENSDTVQEQEHHVQRQQQQ LEEPPFHAHPHNKPIAERSDKSRSAGGFGGEKVEGAGGGVPLSYVYLSPSNVYNLVRT " ORIGIN 1 acaactttct tgggcagcat gttcagggta attcaacttt acatcctcat cctggtctgt 61 tgctttgcat tgatgaggac acagcaccag cagcagacgg gaaatcagtt ccagccttca 121 tggctctact cgatgccctg gcgtccattg atcctgccca cagctaatcc tttgcctcca 181 atggcgggga ttgcccaact gagtcctggt tacacgggtc cacagacgtt tcctccagtt 241 ccacaggatc aacagcaatt taacatccca cagcagcagc ttcgggcact agctctacag 301 caatatccac agccatatca gcccgtactg gtgggtctat tcactcctca gctgcagcct 361 cttcccctgg cagctcctcc accggctgga cattttggtc tgcccttcag gtcatcacct 421 ttcgccggtt acacggatga cgagaatagt gatacggtgc aggagcagga acaccatgtc 481 caacgacagc agcagcaact ggaggaacct ccattccatg cccatcccca taataagcca 541 atagctgagc ggtcggataa gtcaaggagt gccggaggat ttgggggaga gaaggttgaa 601 ggtgcaggag gaggtgtccc actaagctat gtctatttat cccctagtaa tgtttataat 661 ctcgtaagaa cttag