PREDICTED: Drosophila takahashii transmembrane protein 242

LOCUS       XM_017155763             619 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066956), mRNA.
ACCESSION   XM_017155763
VERSION     XM_017155763.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155763.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..619
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..619
                     /gene="LOC108066956"
                     /note="transmembrane protein 242; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108066956"
     CDS             117..557
                     /gene="LOC108066956"
                     /codon_start=1
                     /product="transmembrane protein 242"
                     /protein_id="XP_017011252.1"
                     /db_xref="GeneID:108066956"
                     /translation="MSEAGTNADAVAAEKERKFRIQAAAFLGLVGGVSALFGFSRTLA
                     TAKKTDSKVLQQAGTRQGMILMDEGATLALRALGWGTLYAVAGTGAFCYGFWKLSGAK
                     DFQEFRLKMGNALPRITKDEPPASRTDFESLTDLMKYLAAWNKE"
     misc_feature    123..470
                     /gene="LOC108066956"
                     /note="Protein of unknown function (DUF1358); Region:
                     DUF1358; pfam07096"
                     /db_xref="CDD:429291"
     polyA_site      619
                     /gene="LOC108066956"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgctgcgaaa taccggccgg tcaagcggtc aagcgatcag ctgtgcagtg cgctccgctt
       61 tgggtaatta cgacaaataa tagatcgcag aagcagccgg aagaagcagt gggacgatga
      121 gcgaggccgg caccaacgcg gatgcagtgg cggccgagaa ggagcgcaag ttccgcatcc
      181 aggccgccgc ctttctgggc ctggtcggcg gcgtgtccgc tctgttcggg ttctcccgca
      241 cgctggccac cgcgaagaag acggacagca aggtcctcca gcaggctgga accaggcaag
      301 gaatgatcct gatggacgag ggcgccactc tggccctgcg ggcactcggc tggggcactc
      361 tgtacgccgt cgcgggcacc ggcgcctttt gctacggctt ctggaagctc tcgggagcca
      421 aagatttcca ggagttccgg ctcaagatgg gcaacgcact gcccaggatc accaaggacg
      481 aaccgcccgc cagccgcacc gacttcgaga gcctcacgga cctcatgaag tacctggccg
      541 cctggaacaa ggaatgagca gctcacaaac acacactttt tgattaaaca cccgaatgcc
      601 tgagaagact agctaaaaa