PREDICTED: Drosophila takahashii enhancer of yellow 2 (e(y)2),

LOCUS       XM_017155756             465 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_017155756
VERSION     XM_017155756.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155756.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..465
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..465
                     /gene="e(y)2"
                     /note="enhancer of yellow 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108066950"
     CDS             75..365
                     /gene="e(y)2"
                     /codon_start=1
                     /product="enhancer of yellow 2 transcription factor
                     isoform X2"
                     /protein_id="XP_017011245.1"
                     /db_xref="GeneID:108066950"
                     /translation="MDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRSILLEKGS
                     NNSFTVEQLITEVTPKARTLVPDAVKKELLMKIRTILTENEEEEAEEPEEES"
     misc_feature    78..314
                     /gene="e(y)2"
                     /note="Transcription factor e(y)2; Region: EnY2;
                     pfam10163"
                     /db_xref="CDD:462972"
     polyA_site      465
                     /gene="e(y)2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgggcactg accacaacaa caacacgaca ggcggaaagg agaagagaag acgcgacgcc
       61 ccgaagcctc aaaaatggac cagtacacgg tgctaacggg tgaccgctcc aagatcaagg
      121 atctcctgtg cagccggcta accgaatgcg gttggcggga tgaagtgcgt ctgatgtgcc
      181 gctccattct gctggagaag ggttcgaata acagcttcac cgtggagcag ctcatcaccg
      241 aggtgacgcc caaggcacgc accctcgttc ccgatgccgt caagaaggag ctgctcatga
      301 agatccgcac cattctcacc gaaaacgagg aggaggaggc cgaggagccg gaggaggagt
      361 cctaaaatcc accacatccc tgatttccac taacttgcta accactacag taattactct
      421 cgtttatttg tacggtttta tacataaatc ccataaatcc aggga