PREDICTED: Drosophila takahashii enhancer of yellow 2 (e(y)2),

LOCUS       XM_017155755             473 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_017155755
VERSION     XM_017155755.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155755.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..473
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..473
                     /gene="e(y)2"
                     /note="enhancer of yellow 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108066950"
     CDS             65..373
                     /gene="e(y)2"
                     /codon_start=1
                     /product="enhancer of yellow 2 transcription factor
                     isoform X1"
                     /protein_id="XP_017011244.1"
                     /db_xref="GeneID:108066950"
                     /translation="MTVSAAVDQYTVLTGDRSKIKDLLCSRLTECGWRDEVRLMCRSI
                     LLEKGSNNSFTVEQLITEVTPKARTLVPDAVKKELLMKIRTILTENEEEEAEEPEEES
                     "
     misc_feature    83..322
                     /gene="e(y)2"
                     /note="Transcription factor e(y)2; Region: EnY2;
                     pfam10163"
                     /db_xref="CDD:462972"
     polyA_site      473
                     /gene="e(y)2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cacaacaaca acacgacagg cggaaaggag aagagaagac gcgacgcccc gaagcctcaa
       61 aaaaatgacc gtttccgccg cagtggacca gtacacggtg ctaacgggtg accgctccaa
      121 gatcaaggat ctcctgtgca gccggctaac cgaatgcggt tggcgggatg aagtgcgtct
      181 gatgtgccgc tccattctgc tggagaaggg ttcgaataac agcttcaccg tggagcagct
      241 catcaccgag gtgacgccca aggcacgcac cctcgttccc gatgccgtca agaaggagct
      301 gctcatgaag atccgcacca ttctcaccga aaacgaggag gaggaggccg aggagccgga
      361 ggaggagtcc taaaatccac cacatccctg atttccacta acttgctaac cactacagta
      421 attactctcg tttatttgta cggttttata cataaatccc ataaatccag gga