Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155753 1510 bp mRNA linear INV 09-DEC-2024 (Uba5), mRNA. ACCESSION XM_017155753 VERSION XM_017155753.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155753.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1510 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1510 /gene="Uba5" /note="Ubiquitin-like activating enzyme 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:108066948" CDS 119..1348 /gene="Uba5" /codon_start=1 /product="ubiquitin-like modifier-activating enzyme 5" /protein_id="XP_017011242.2" /db_xref="GeneID:108066948" /translation="MSHAIDELQAIIAELKTELEEPKATGSSSGNGNINKNQVRDRIE RMSAEVVDSNPYSRLMALQRMNIVKDYERIRDKAVAIVGVGGVGSVTADMLTRCGIGK LILFDYDKVELANMNRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVDNF DGFLETISRGGRIAGQPVDLVLSCVDNFEARMTINTACNELNLNWFESGVSENAVSGH IQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNALKYL LNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRHCLARQKEFQARPKPKVVEEVKAAS EEPLHATNEWGIELVAEDEPVASNSTADEASKVGEGLRLAYEAPEKDNENLGAPAAEA AEDGASLEDLMAQMKSM" misc_feature 281..1018 /gene="Uba5" /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD...; Region: ThiF_MoeB_HesA_family; cd00757" /db_xref="CDD:238386" misc_feature order(365..367,371..373,377..379,437..439,443..445, 470..472,506..508,668..670,686..688) /gene="Uba5" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:238386" misc_feature order(377..379,671..679,689..691,743..748,764..766, 770..772,971..973,983..985,1004..1006,1010..1015) /gene="Uba5" /note="substrate interface [chemical binding]; other site" /db_xref="CDD:238386" ORIGIN 1 cagtaggacc gtatttgcaa aaacacaact acgtggctgc gattaaaaac ttgaaagcga 61 aagttgaaag tttaagaggc tttggaggat ccgccacggg aggaaccttt tcgccaggat 121 gtcgcacgcc atcgacgaac tgcaggcgat catcgccgag ctgaaaacgg agctagagga 181 gccaaaggcc accgggagca gcagtggaaa tggaaacata aataaaaacc aagtccgcga 241 tcgcattgaa cgcatgtccg ccgaggtggt ggattccaat ccctacagcc gcctgatggc 301 cctgcagcgg atgaacatcg tcaaggatta cgagcggatc cgcgacaagg cggtggccat 361 tgtgggcgtg ggcggcgtgg gaagcgtcac cgccgacatg ctgacacgct gcggcattgg 421 caaactgatc ctcttcgact acgacaaggt ggagctggcg aacatgaacc gtctgttctt 481 tacgcccgac caggcgggcc tctccaaggt ggccgccgcc gccgccacgc tgagcttcat 541 caatccggac gtggagatcg agacgcacaa ctacaacatc acgacggtgg acaacttcga 601 tggcttcctg gagacgatct cgcgcggcgg tcgcattgcc ggccagccgg tggatttggt 661 gctcagctgt gtggacaatt tcgaggcgcg aatgaccata aatacggcct gcaatgagct 721 gaatctcaat tggttcgagt cgggcgtttc ggagaatgcc gtctccgggc atattcagtt 781 tattcgtcct ggggacaccg cctgtttcgc ctgcgctcct cctttggtgg tggccgagaa 841 cattgacgaa aagacgctga aaagggaagg cgtttgcgcc gcctcgctgc ccacaaccat 901 gggcataacg gctggattcc tggtgcaaaa tgccctcaag tatctgctga atttcggcga 961 ggtatccgac tatctgggct acaatgcgct gagcgacttc tttcccaaga tgacgctcaa 1021 gccgaatccg cagtgcgacg atcggcactg tttggccagg caaaaggagt tccaggcgag 1081 gccgaaaccg aaagtagtag aggaggtgaa ggcagccagc gaggagccgc tgcacgccac 1141 taacgaatgg ggcattgaat tggtggccga ggatgagccg gtggccagta attcaacggc 1201 agatgaagcc tctaaagttg gcgaaggtct gagactggcc tacgaggcac ctgaaaagga 1261 taatgaaaat ctaggagcac ctgcagccga agcagcggaa gacggcgcca gtttggagga 1321 cctaatggcg cagatgaagt ccatgtgaat gatcgcctca attccatact ctctaattta 1381 tagacacttt ttaatgtaaa gcatttcttt tttttgtact gtataaactg cgttttgttt 1441 gtgtgacagt tggcccagcc atttgtgagg tctttgaaca taaaatgcca gctgacaagg 1501 tggaaaacaa