Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ubiquitin-like activating enzyme 5


LOCUS       XM_017155753            1510 bp    mRNA    linear   INV 09-DEC-2024
            (Uba5), mRNA.
ACCESSION   XM_017155753
VERSION     XM_017155753.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155753.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1510
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1510
                     /gene="Uba5"
                     /note="Ubiquitin-like activating enzyme 5; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 14 Proteins"
                     /db_xref="GeneID:108066948"
     CDS             119..1348
                     /gene="Uba5"
                     /codon_start=1
                     /product="ubiquitin-like modifier-activating enzyme 5"
                     /protein_id="XP_017011242.2"
                     /db_xref="GeneID:108066948"
                     /translation="MSHAIDELQAIIAELKTELEEPKATGSSSGNGNINKNQVRDRIE
                     RMSAEVVDSNPYSRLMALQRMNIVKDYERIRDKAVAIVGVGGVGSVTADMLTRCGIGK
                     LILFDYDKVELANMNRLFFTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVDNF
                     DGFLETISRGGRIAGQPVDLVLSCVDNFEARMTINTACNELNLNWFESGVSENAVSGH
                     IQFIRPGDTACFACAPPLVVAENIDEKTLKREGVCAASLPTTMGITAGFLVQNALKYL
                     LNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRHCLARQKEFQARPKPKVVEEVKAAS
                     EEPLHATNEWGIELVAEDEPVASNSTADEASKVGEGLRLAYEAPEKDNENLGAPAAEA
                     AEDGASLEDLMAQMKSM"
     misc_feature    281..1018
                     /gene="Uba5"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    order(365..367,371..373,377..379,437..439,443..445,
                     470..472,506..508,668..670,686..688)
                     /gene="Uba5"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    order(377..379,671..679,689..691,743..748,764..766,
                     770..772,971..973,983..985,1004..1006,1010..1015)
                     /gene="Uba5"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
ORIGIN      
        1 cagtaggacc gtatttgcaa aaacacaact acgtggctgc gattaaaaac ttgaaagcga
       61 aagttgaaag tttaagaggc tttggaggat ccgccacggg aggaaccttt tcgccaggat
      121 gtcgcacgcc atcgacgaac tgcaggcgat catcgccgag ctgaaaacgg agctagagga
      181 gccaaaggcc accgggagca gcagtggaaa tggaaacata aataaaaacc aagtccgcga
      241 tcgcattgaa cgcatgtccg ccgaggtggt ggattccaat ccctacagcc gcctgatggc
      301 cctgcagcgg atgaacatcg tcaaggatta cgagcggatc cgcgacaagg cggtggccat
      361 tgtgggcgtg ggcggcgtgg gaagcgtcac cgccgacatg ctgacacgct gcggcattgg
      421 caaactgatc ctcttcgact acgacaaggt ggagctggcg aacatgaacc gtctgttctt
      481 tacgcccgac caggcgggcc tctccaaggt ggccgccgcc gccgccacgc tgagcttcat
      541 caatccggac gtggagatcg agacgcacaa ctacaacatc acgacggtgg acaacttcga
      601 tggcttcctg gagacgatct cgcgcggcgg tcgcattgcc ggccagccgg tggatttggt
      661 gctcagctgt gtggacaatt tcgaggcgcg aatgaccata aatacggcct gcaatgagct
      721 gaatctcaat tggttcgagt cgggcgtttc ggagaatgcc gtctccgggc atattcagtt
      781 tattcgtcct ggggacaccg cctgtttcgc ctgcgctcct cctttggtgg tggccgagaa
      841 cattgacgaa aagacgctga aaagggaagg cgtttgcgcc gcctcgctgc ccacaaccat
      901 gggcataacg gctggattcc tggtgcaaaa tgccctcaag tatctgctga atttcggcga
      961 ggtatccgac tatctgggct acaatgcgct gagcgacttc tttcccaaga tgacgctcaa
     1021 gccgaatccg cagtgcgacg atcggcactg tttggccagg caaaaggagt tccaggcgag
     1081 gccgaaaccg aaagtagtag aggaggtgaa ggcagccagc gaggagccgc tgcacgccac
     1141 taacgaatgg ggcattgaat tggtggccga ggatgagccg gtggccagta attcaacggc
     1201 agatgaagcc tctaaagttg gcgaaggtct gagactggcc tacgaggcac ctgaaaagga
     1261 taatgaaaat ctaggagcac ctgcagccga agcagcggaa gacggcgcca gtttggagga
     1321 cctaatggcg cagatgaagt ccatgtgaat gatcgcctca attccatact ctctaattta
     1381 tagacacttt ttaatgtaaa gcatttcttt tttttgtact gtataaactg cgttttgttt
     1441 gtgtgacagt tggcccagcc atttgtgagg tctttgaaca taaaatgcca gctgacaagg
     1501 tggaaaacaa