Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii sulfiredoxin (Srx), transcript


LOCUS       XM_017155741             546 bp    mRNA    linear   INV 09-DEC-2024
            variant X2, mRNA.
ACCESSION   XM_017155741
VERSION     XM_017155741.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155741.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..546
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..546
                     /gene="Srx"
                     /note="sulfiredoxin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108066939"
     CDS             39..479
                     /gene="Srx"
                     /codon_start=1
                     /product="sulfiredoxin isoform X2"
                     /protein_id="XP_017011230.2"
                     /db_xref="GeneID:108066939"
                     /translation="MEFISQFIRLASRRGNGFGPILQRNRSSIVQKDTMDTTIHSAGI
                     AEIHMVPMSVIQRPIPSVLDEKKVQSLMETIKGESSEDEVPPIDLLWITGDEGGDYYF
                     SFGGCHRFEAYKRLQRPEIKAKLVKSTLGDLYHYMGSSAPKYLA"
     misc_feature    177..452
                     /gene="Srx"
                     /note="Sulfiredoxin reactivates peroxiredoxins after
                     oxidative inactivation; Region: Srx; cd16395"
                     /db_xref="CDD:319253"
     misc_feature    order(180..191,204..218,300..302,306..311,333..341,
                     348..353,402..404,411..416,429..431,438..443)
                     /gene="Srx"
                     /note="peroxiredoxin binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:319253"
     misc_feature    order(237..239,246..251,258..260,285..287,291..293,
                     351..365)
                     /gene="Srx"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:319253"
     polyA_site      546
                     /gene="Srx"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caagtttcaa cggcgcagaa atcgttcaat tggccgccat ggagttcatt agccagttca
       61 tacgactggc gagcagacgc ggcaacggat tcggtccaat cctgcagaga aatcggagca
      121 gcatcgtcca aaaagacacc atggacacca ccatccactc agcgggcata gccgagatcc
      181 acatggttcc catgagcgtc attcagaggc ccataccctc cgttcttgac gagaagaagg
      241 tgcaatccct gatggaaacc attaagggcg aaagcagcga ggacgaggtg ccccccatcg
      301 atctgctgtg gatcacgggc gacgagggcg gcgactacta cttcagcttc ggcggatgcc
      361 accggttcga ggcctacaag cgtctgcagc ggccggagat caaggcgaag ctggtgaagt
      421 ccaccttggg ggatctgtac cactacatgg gctccagtgc acccaagtac ctggcctgat
      481 ttatgttata tatatatgtg tgtattttag aaatgcattt ctcgttgact tatttttgat
      541 aagaaa