Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155740 546 bp mRNA linear INV 09-DEC-2024 variant X1, mRNA. ACCESSION XM_017155740 VERSION XM_017155740.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155740.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..546 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..546 /gene="Srx" /note="sulfiredoxin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108066939" CDS 36..479 /gene="Srx" /codon_start=1 /product="sulfiredoxin isoform X1" /protein_id="XP_017011229.2" /db_xref="GeneID:108066939" /translation="MEFISQFIRLASRRGNGFGPILQRNRSSIVQKDSTMDTTIHSAG IAEIHMVPMSVIQRPIPSVLDEKKVQSLMETIKGESSEDEVPPIDLLWITGDEGGDYY FSFGGCHRFEAYKRLQRPEIKAKLVKSTLGDLYHYMGSSAPKYLA" misc_feature 177..452 /gene="Srx" /note="Sulfiredoxin reactivates peroxiredoxins after oxidative inactivation; Region: Srx; cd16395" /db_xref="CDD:319253" misc_feature order(180..191,204..218,300..302,306..311,333..341, 348..353,402..404,411..416,429..431,438..443) /gene="Srx" /note="peroxiredoxin binding site [polypeptide binding]; other site" /db_xref="CDD:319253" misc_feature order(237..239,246..251,258..260,285..287,291..293, 351..365) /gene="Srx" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:319253" polyA_site 546 /gene="Srx" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtttcaacgg cgcagaaatc gttcaattgg ccgccatgga gttcattagc cagttcatac 61 gactggcgag cagacgcggc aacggattcg gtccaatcct gcagagaaat cggagcagca 121 tcgtccaaaa agacagcacc atggacacca ccatccactc agcgggcata gccgagatcc 181 acatggttcc catgagcgtc attcagaggc ccataccctc cgttcttgac gagaagaagg 241 tgcaatccct gatggaaacc attaagggcg aaagcagcga ggacgaggtg ccccccatcg 301 atctgctgtg gatcacgggc gacgagggcg gcgactacta cttcagcttc ggcggatgcc 361 accggttcga ggcctacaag cgtctgcagc ggccggagat caaggcgaag ctggtgaagt 421 ccaccttggg ggatctgtac cactacatgg gctccagtgc acccaagtac ctggcctgat 481 ttatgttata tatatatgtg tgtattttag aaatgcattt ctcgttgact tatttttgat 541 aagaaa