Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155739 1253 bp mRNA linear INV 09-DEC-2024 (LOC108066938), mRNA. ACCESSION XM_017155739 VERSION XM_017155739.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155739.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1253 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1253 /gene="LOC108066938" /note="venom protease-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108066938" CDS 37..1173 /gene="LOC108066938" /codon_start=1 /product="venom protease-like" /protein_id="XP_017011228.2" /db_xref="GeneID:108066938" /translation="MVLRSSIALYLYLCGVLLSSCFAKPKLHFGSCRGSGQCRLLSDC LEEPGYVLAEDSSECFNTFCCLKKQPVYPQSVDNYCRHDLKPHISNGEVTKRREFPWM AMLLYGDRLTPKCGGSLVGNQWVLTAAHCVPSQPYEEDLRLVRLGVWDVQQLTDSQDI PIARTIVHEKYLPAETTGTNLEKHSNDIALLVLERVVTYSEFIQPICLPSSLYPRRGD NYVNYGLTIAGWGRTSEESTATAPVKIKARVNGWSRDSCLERYKDLADGQMCAGGDKS RKGSCFGDSGGPVMDGNQLVGIVSLGEARCGSDRGPMVVTRVDSYLAWLGEHFLDRPE SPEPKIEQPIKRNSGFFNIFARRVFGNAENQTNQGDQEVVPFAL" misc_feature 295..1008 /gene="LOC108066938" /note="Trypsin-like serine protease; Region: Tryp_SPc; smart00020" /db_xref="CDD:214473" misc_feature 298..300 /gene="LOC108066938" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(424..426,595..597,889..891) /gene="LOC108066938" /note="active site" /db_xref="CDD:238113" misc_feature order(871..873,934..936,940..942) /gene="LOC108066938" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" ORIGIN 1 tcagataagc cactgcatcg attcagacta agagccatgg ttctccgatc ttcaattgca 61 ttgtatctgt atctctgcgg ggtgctttta tccagctgtt ttgccaaacc gaagctgcac 121 tttggcagct gtcggggatc gggccagtgc cgcctgctgt cggactgcct ggaggagccg 181 ggctacgtgc tggcggagga ctcctccgag tgcttcaaca cgttctgctg tctgaagaaa 241 cagccggtgt atccgcagtc ggtggacaac tactgccgcc acgacctcaa gccgcacatc 301 tcgaacggag aggtgaccaa gcggcgcgag ttcccctgga tggccatgct gctgtacggc 361 gatcggctga cgcccaagtg cggtggctcc ctggtgggca accagtgggt cctgaccgcc 421 gcccactgtg tgcccagtca gccgtacgag gaggacctgc gactcgttcg cctgggcgtc 481 tgggatgtcc agcagctgac ggactcgcag gacatcccca tagctcgaac aattgtccac 541 gagaagtacc tgccggcgga gacgacgggc acgaatctgg agaagcactc caatgacatt 601 gccctgctgg ttttggagcg agtggtcacc tactcggagt tcatccagcc catctgcctg 661 ccctccagcc tttatccgcg gcgcggcgac aactatgtga actacggcct gaccatcgcc 721 ggctggggcc gcaccagcga ggagtccacg gccacggcgc cggtgaagat caaggcccgg 781 gtgaatggat ggtcgcggga cagctgcctg gagaggtaca aggacctggc cgatggacag 841 atgtgcgccg gcggggataa gtccaggaag ggcagctgct tcggcgactc cggcggcccc 901 gtgatggacg gcaaccagct ggtgggcatc gtctcgctgg gggaggccag gtgcggttcg 961 gatcggggac ccatggtcgt cacgcgagtc gactcctatt tggcctggct gggggagcac 1021 ttcctcgatc gcccggaatc gccggaacca aaaatcgagc aacccatcaa aagaaactcg 1081 ggctttttta acattttcgc aagaagagtt tttggcaacg cagaaaacca aacaaatcaa 1141 ggagatcaag aagttgtgcc ctttgctctt tgaaaaatct attaaatcga ggagaaaaag 1201 tgaaaaagaa gcgagattgc gcctaaaact acgaaagtgg aagcgagaaa gac