Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii venom protease-like


LOCUS       XM_017155739            1253 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066938), mRNA.
ACCESSION   XM_017155739
VERSION     XM_017155739.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155739.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1253
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1253
                     /gene="LOC108066938"
                     /note="venom protease-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108066938"
     CDS             37..1173
                     /gene="LOC108066938"
                     /codon_start=1
                     /product="venom protease-like"
                     /protein_id="XP_017011228.2"
                     /db_xref="GeneID:108066938"
                     /translation="MVLRSSIALYLYLCGVLLSSCFAKPKLHFGSCRGSGQCRLLSDC
                     LEEPGYVLAEDSSECFNTFCCLKKQPVYPQSVDNYCRHDLKPHISNGEVTKRREFPWM
                     AMLLYGDRLTPKCGGSLVGNQWVLTAAHCVPSQPYEEDLRLVRLGVWDVQQLTDSQDI
                     PIARTIVHEKYLPAETTGTNLEKHSNDIALLVLERVVTYSEFIQPICLPSSLYPRRGD
                     NYVNYGLTIAGWGRTSEESTATAPVKIKARVNGWSRDSCLERYKDLADGQMCAGGDKS
                     RKGSCFGDSGGPVMDGNQLVGIVSLGEARCGSDRGPMVVTRVDSYLAWLGEHFLDRPE
                     SPEPKIEQPIKRNSGFFNIFARRVFGNAENQTNQGDQEVVPFAL"
     misc_feature    295..1008
                     /gene="LOC108066938"
                     /note="Trypsin-like serine protease; Region: Tryp_SPc;
                     smart00020"
                     /db_xref="CDD:214473"
     misc_feature    298..300
                     /gene="LOC108066938"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(424..426,595..597,889..891)
                     /gene="LOC108066938"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(871..873,934..936,940..942)
                     /gene="LOC108066938"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 tcagataagc cactgcatcg attcagacta agagccatgg ttctccgatc ttcaattgca
       61 ttgtatctgt atctctgcgg ggtgctttta tccagctgtt ttgccaaacc gaagctgcac
      121 tttggcagct gtcggggatc gggccagtgc cgcctgctgt cggactgcct ggaggagccg
      181 ggctacgtgc tggcggagga ctcctccgag tgcttcaaca cgttctgctg tctgaagaaa
      241 cagccggtgt atccgcagtc ggtggacaac tactgccgcc acgacctcaa gccgcacatc
      301 tcgaacggag aggtgaccaa gcggcgcgag ttcccctgga tggccatgct gctgtacggc
      361 gatcggctga cgcccaagtg cggtggctcc ctggtgggca accagtgggt cctgaccgcc
      421 gcccactgtg tgcccagtca gccgtacgag gaggacctgc gactcgttcg cctgggcgtc
      481 tgggatgtcc agcagctgac ggactcgcag gacatcccca tagctcgaac aattgtccac
      541 gagaagtacc tgccggcgga gacgacgggc acgaatctgg agaagcactc caatgacatt
      601 gccctgctgg ttttggagcg agtggtcacc tactcggagt tcatccagcc catctgcctg
      661 ccctccagcc tttatccgcg gcgcggcgac aactatgtga actacggcct gaccatcgcc
      721 ggctggggcc gcaccagcga ggagtccacg gccacggcgc cggtgaagat caaggcccgg
      781 gtgaatggat ggtcgcggga cagctgcctg gagaggtaca aggacctggc cgatggacag
      841 atgtgcgccg gcggggataa gtccaggaag ggcagctgct tcggcgactc cggcggcccc
      901 gtgatggacg gcaaccagct ggtgggcatc gtctcgctgg gggaggccag gtgcggttcg
      961 gatcggggac ccatggtcgt cacgcgagtc gactcctatt tggcctggct gggggagcac
     1021 ttcctcgatc gcccggaatc gccggaacca aaaatcgagc aacccatcaa aagaaactcg
     1081 ggctttttta acattttcgc aagaagagtt tttggcaacg cagaaaacca aacaaatcaa
     1141 ggagatcaag aagttgtgcc ctttgctctt tgaaaaatct attaaatcga ggagaaaaag
     1201 tgaaaaagaa gcgagattgc gcctaaaact acgaaagtgg aagcgagaaa gac