Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Actin-related protein 8 (Arp8),


LOCUS       XM_017155738            2101 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017155738
VERSION     XM_017155738.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155738.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2101
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2101
                     /gene="Arp8"
                     /note="Actin-related protein 8; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108066937"
     CDS             93..1859
                     /gene="Arp8"
                     /codon_start=1
                     /product="actin-related protein 8"
                     /protein_id="XP_017011227.2"
                     /db_xref="GeneID:108066937"
                     /translation="MQRSRASSTSSGRLPAPPPMGAPPPQPLEAPKIIVIHPGSQHLR
                     IGRAADLNPLTLLHAVAYRRRLATATDQPHHDPLLPPLDNVNTTALMVDFEEQRLAVS
                     RILQHCVVDEKNRLRVATPPQQLAHFNRSSQAEKVQMQVIPEEELPWLEHLFDDRILR
                     LSAQDARDYDIHFPMQRGELNVHKEKGGSLQASLQHLERIWSYALETRLKIPLRELNT
                     HCAVLVVNDVYVRRHLRELMTLLLQRLGFRRCFLVQDSVASTYGAGIGYGCVVDIGAQ
                     KTSIACIEDGISQLDARVRLPYGGGDLDQVLLLLLRKCGFPYRECNVQDSYADAHLLD
                     ELKERFCHLNASVCGAQEKHFNLRRPNGQWLRYTIQVGDEAIMAPLALFHTELLNITG
                     RMRSVCTQQAAQEQYDCEDCFDAEYLKETGRKNGLSTATQQRSQLQLPVTADDEEQLI
                     VVDQTTEDQANSNGQQTNCYQNGQTGQVLPLDQAVIRSISRLSSGETRRKMFGSILLV
                     GSSAKLPGLAAWLEHRISQQIQPTDTEVNVFTKGMDAGMVAWKGAAIMSVLESARELW
                     ISQHDWQRHGLRILRERSPFLW"
     misc_feature    186..1841
                     /gene="Arp8"
                     /note="nucleotide-binding domain (NBD) of the
                     actin-related protein 8 (Arp8)-like subfamily; Region:
                     ASKHA_NBD_Arp8-like; cd10206"
                     /db_xref="CDD:466812"
ORIGIN      
        1 tcgtagcctg gtcacacaca gcttttgttg ttcttttaat ttcccggctt tccgctgttt
       61 ttcgctgttt tccgccgctg ttttcccgca ggatgcagcg atcccgtgcc agcagcacca
      121 gcagtggccg cctgccggct cctccgccaa tgggagctcc tcctccgcag cccctggagg
      181 cgcccaagat cattgtcatc catccgggat cgcagcattt gaggataggc cgggcggccg
      241 acctgaatcc gctcaccctg ctgcacgcgg tggcctacag gcgtcgcttg gccacggcta
      301 cggaccaacc gcatcatgat cctctcctgc cgccgctgga caacgtgaac accactgctt
      361 taatggtgga ctttgaggag cagcgcctgg cggtgtcgcg catcctgcag cactgcgtcg
      421 tggatgagaa gaatcgtttg agggtggcca cgccgcccca gcagttggcc cacttcaatc
      481 ggagcagcca ggcggagaag gtgcagatgc aggtgatccc agaggaggag ttgccctggc
      541 tggagcacct cttcgacgac cggatactgc gactgagcgc tcaggatgcc cgcgactacg
      601 acatccactt tcccatgcag cggggcgaac tgaatgtgca caaggagaag ggcggctccc
      661 tgcaggccag cctgcagcac ttggagcgca tctggtcata tgctctagag acccgtctca
      721 agatcccgct gcgcgaactg aacacccact gtgccgtcct cgtggtcaac gatgtctatg
      781 tgcggcggca tctgcgcgag ctgatgaccc tgctgctgca gcgcctcggc ttcaggcgct
      841 gcttcctcgt ccaggacagc gtggcttcca cctatggcgc cggcattggc tacggctgtg
      901 tggtggacat tggcgcccaa aagacctcga ttgcttgcat cgaggatggg atttcccagc
      961 tggatgcccg cgtgcggctg ccctatggcg gcggcgatct ggatcaagtg cttctcctgc
     1021 tcctgcgcaa atgtggcttt ccctaccgcg agtgcaacgt tcaggacagc tatgcggatg
     1081 cccatctgct ggacgagctg aaggagcggt tctgccatct caatgccagc gtctgtggcg
     1141 cccaggagaa gcactttaat ctgcgccggc caaacggcca gtggctgcgc tacaccatcc
     1201 aggtgggcga cgaggccatc atggcgcctc tggccctctt tcacaccgaa ctgctcaaca
     1261 ttacgggccg catgcggtcg gtttgcacgc agcaggctgc gcaggagcag tacgactgcg
     1321 aggactgctt cgatgcggag tatctgaagg agacgggccg caagaacggc ctctccacgg
     1381 caacccagca acgctctcag ctccaactgc cggtgaccgc cgacgatgag gagcagctga
     1441 ttgtggtgga tcagacgacg gaggatcagg cgaacagcaa tggccagcag acgaactgct
     1501 atcagaatgg ccagacgggt caggtgttgc ccctcgatca ggccgtcatc cgatccatca
     1561 gccgtctgtc cagcggcgag acgaggcgca agatgttcgg ttccatactg ctcgtcggca
     1621 gcagtgccaa gctgccggga ctggccgcct ggctggagca tcggattagc cagcaaattc
     1681 agcccaccga caccgaggtg aatgtcttca ccaagggcat ggacgcgggc atggtggcct
     1741 ggaagggagc ggccattatg tccgtgctgg agagcgcccg cgagctgtgg atatcgcagc
     1801 acgactggca gcgccacgga ctgcggatac tccgcgagcg atcgccgttc ctctggtgag
     1861 gatgacccat tgcatttcga atatgttcag cgttcaggga gatcgtatat gtcaataata
     1921 gcgtttagta aagagagaag tcccgaagtc ataagaaata gtaaaccatt taagagtcca
     1981 gcgataagct cgctatatac gcaagtttaa tgattgccaa aaaaaataaa caaagtataa
     2041 agctattgtt attgctttga ccgtgaaatt ccaactttat ccggttataa gtaaaaaaca
     2101 c