Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155738 2101 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017155738 VERSION XM_017155738.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155738.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2101 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..2101 /gene="Arp8" /note="Actin-related protein 8; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108066937" CDS 93..1859 /gene="Arp8" /codon_start=1 /product="actin-related protein 8" /protein_id="XP_017011227.2" /db_xref="GeneID:108066937" /translation="MQRSRASSTSSGRLPAPPPMGAPPPQPLEAPKIIVIHPGSQHLR IGRAADLNPLTLLHAVAYRRRLATATDQPHHDPLLPPLDNVNTTALMVDFEEQRLAVS RILQHCVVDEKNRLRVATPPQQLAHFNRSSQAEKVQMQVIPEEELPWLEHLFDDRILR LSAQDARDYDIHFPMQRGELNVHKEKGGSLQASLQHLERIWSYALETRLKIPLRELNT HCAVLVVNDVYVRRHLRELMTLLLQRLGFRRCFLVQDSVASTYGAGIGYGCVVDIGAQ KTSIACIEDGISQLDARVRLPYGGGDLDQVLLLLLRKCGFPYRECNVQDSYADAHLLD ELKERFCHLNASVCGAQEKHFNLRRPNGQWLRYTIQVGDEAIMAPLALFHTELLNITG RMRSVCTQQAAQEQYDCEDCFDAEYLKETGRKNGLSTATQQRSQLQLPVTADDEEQLI VVDQTTEDQANSNGQQTNCYQNGQTGQVLPLDQAVIRSISRLSSGETRRKMFGSILLV GSSAKLPGLAAWLEHRISQQIQPTDTEVNVFTKGMDAGMVAWKGAAIMSVLESARELW ISQHDWQRHGLRILRERSPFLW" misc_feature 186..1841 /gene="Arp8" /note="nucleotide-binding domain (NBD) of the actin-related protein 8 (Arp8)-like subfamily; Region: ASKHA_NBD_Arp8-like; cd10206" /db_xref="CDD:466812" ORIGIN 1 tcgtagcctg gtcacacaca gcttttgttg ttcttttaat ttcccggctt tccgctgttt 61 ttcgctgttt tccgccgctg ttttcccgca ggatgcagcg atcccgtgcc agcagcacca 121 gcagtggccg cctgccggct cctccgccaa tgggagctcc tcctccgcag cccctggagg 181 cgcccaagat cattgtcatc catccgggat cgcagcattt gaggataggc cgggcggccg 241 acctgaatcc gctcaccctg ctgcacgcgg tggcctacag gcgtcgcttg gccacggcta 301 cggaccaacc gcatcatgat cctctcctgc cgccgctgga caacgtgaac accactgctt 361 taatggtgga ctttgaggag cagcgcctgg cggtgtcgcg catcctgcag cactgcgtcg 421 tggatgagaa gaatcgtttg agggtggcca cgccgcccca gcagttggcc cacttcaatc 481 ggagcagcca ggcggagaag gtgcagatgc aggtgatccc agaggaggag ttgccctggc 541 tggagcacct cttcgacgac cggatactgc gactgagcgc tcaggatgcc cgcgactacg 601 acatccactt tcccatgcag cggggcgaac tgaatgtgca caaggagaag ggcggctccc 661 tgcaggccag cctgcagcac ttggagcgca tctggtcata tgctctagag acccgtctca 721 agatcccgct gcgcgaactg aacacccact gtgccgtcct cgtggtcaac gatgtctatg 781 tgcggcggca tctgcgcgag ctgatgaccc tgctgctgca gcgcctcggc ttcaggcgct 841 gcttcctcgt ccaggacagc gtggcttcca cctatggcgc cggcattggc tacggctgtg 901 tggtggacat tggcgcccaa aagacctcga ttgcttgcat cgaggatggg atttcccagc 961 tggatgcccg cgtgcggctg ccctatggcg gcggcgatct ggatcaagtg cttctcctgc 1021 tcctgcgcaa atgtggcttt ccctaccgcg agtgcaacgt tcaggacagc tatgcggatg 1081 cccatctgct ggacgagctg aaggagcggt tctgccatct caatgccagc gtctgtggcg 1141 cccaggagaa gcactttaat ctgcgccggc caaacggcca gtggctgcgc tacaccatcc 1201 aggtgggcga cgaggccatc atggcgcctc tggccctctt tcacaccgaa ctgctcaaca 1261 ttacgggccg catgcggtcg gtttgcacgc agcaggctgc gcaggagcag tacgactgcg 1321 aggactgctt cgatgcggag tatctgaagg agacgggccg caagaacggc ctctccacgg 1381 caacccagca acgctctcag ctccaactgc cggtgaccgc cgacgatgag gagcagctga 1441 ttgtggtgga tcagacgacg gaggatcagg cgaacagcaa tggccagcag acgaactgct 1501 atcagaatgg ccagacgggt caggtgttgc ccctcgatca ggccgtcatc cgatccatca 1561 gccgtctgtc cagcggcgag acgaggcgca agatgttcgg ttccatactg ctcgtcggca 1621 gcagtgccaa gctgccggga ctggccgcct ggctggagca tcggattagc cagcaaattc 1681 agcccaccga caccgaggtg aatgtcttca ccaagggcat ggacgcgggc atggtggcct 1741 ggaagggagc ggccattatg tccgtgctgg agagcgcccg cgagctgtgg atatcgcagc 1801 acgactggca gcgccacgga ctgcggatac tccgcgagcg atcgccgttc ctctggtgag 1861 gatgacccat tgcatttcga atatgttcag cgttcaggga gatcgtatat gtcaataata 1921 gcgtttagta aagagagaag tcccgaagtc ataagaaata gtaaaccatt taagagtcca 1981 gcgataagct cgctatatac gcaagtttaa tgattgccaa aaaaaataaa caaagtataa 2041 agctattgtt attgctttga ccgtgaaatt ccaactttat ccggttataa gtaaaaaaca 2101 c