Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial fission process


LOCUS       XM_017155734             824 bp    mRNA    linear   INV 09-DEC-2024
            protein 1 (LOC108066935), mRNA.
ACCESSION   XM_017155734
VERSION     XM_017155734.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155734.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..824
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..824
                     /gene="LOC108066935"
                     /note="mitochondrial fission process protein 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108066935"
     CDS             204..692
                     /gene="LOC108066935"
                     /codon_start=1
                     /product="mitochondrial fission process protein 1"
                     /protein_id="XP_017011223.2"
                     /db_xref="GeneID:108066935"
                     /translation="MSEDKQIKETVETAFKQPARDVDIYRDTFIRYMGYSNEIGESFR
                     PLVPKSFVAASYGMAIGYVCTDTFDKALRLQMDGASSREVAIKGGDVFCWQMLASVAI
                     PGMVINRITWATKTLLSRAPMPVLKTVPTLVGLASIPLIIHPIDSLVDRLMDASYRKL
                     VR"
     misc_feature    294..662
                     /gene="LOC108066935"
                     /note="Mitochondrial 18 KDa protein (MTP18); Region:
                     MTP18; pfam10558"
                     /db_xref="CDD:431357"
     polyA_site      824
                     /gene="LOC108066935"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agcttaatta caattaatta atatttttaa tttatttgca ccttatcgaa tcccaatcga
       61 atcgaatcca ctgcgtcggt taaatttgaa tttagataaa taatgaactt gtagggaacc
      121 gggcttccag ctgttttccg tcatcatcag atattaccca actcgacatt ccacataaac
      181 agtgataaac tacagtgaag acaatgtcgg aggacaagca aattaaggag actgtggaaa
      241 cggccttcaa acagcccgcc agggatgtgg acatatatcg cgacaccttc attcgctaca
      301 tgggctacag caacgaaatc ggcgagtcct tccgcccact ggtgcccaaa tccttcgtgg
      361 ccgcatccta tggcatggcc atcggttatg tctgcaccga taccttcgat aaggccctgc
      421 gcctccaaat ggacggggca tcctccagag aggtggccat caagggcggc gacgtcttct
      481 gctggcagat gctggcctcc gtcgccattc ccggcatggt catcaatcgg atcacctggg
      541 ccaccaaaac tctgctcagt cgggcgccca tgcccgtgct gaaaacggtg cccactctgg
      601 tgggcctggc cagcatcccg ctgatcatcc atcccatcga cagcctggtg gaccgcctga
      661 tggacgccag ctaccgcaag ctggtgaggt agtgaacgct gcgcatgatc aactactcct
      721 aatccccggt gatagaccct agatactaag agttcgcatt aactgtgttg caaagcttta
      781 atcccaaaat ccagtttaca ccttgacgag gatttctaac tgta