Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155734 824 bp mRNA linear INV 09-DEC-2024 protein 1 (LOC108066935), mRNA. ACCESSION XM_017155734 VERSION XM_017155734.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155734.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..824 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..824 /gene="LOC108066935" /note="mitochondrial fission process protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066935" CDS 204..692 /gene="LOC108066935" /codon_start=1 /product="mitochondrial fission process protein 1" /protein_id="XP_017011223.2" /db_xref="GeneID:108066935" /translation="MSEDKQIKETVETAFKQPARDVDIYRDTFIRYMGYSNEIGESFR PLVPKSFVAASYGMAIGYVCTDTFDKALRLQMDGASSREVAIKGGDVFCWQMLASVAI PGMVINRITWATKTLLSRAPMPVLKTVPTLVGLASIPLIIHPIDSLVDRLMDASYRKL VR" misc_feature 294..662 /gene="LOC108066935" /note="Mitochondrial 18 KDa protein (MTP18); Region: MTP18; pfam10558" /db_xref="CDD:431357" polyA_site 824 /gene="LOC108066935" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agcttaatta caattaatta atatttttaa tttatttgca ccttatcgaa tcccaatcga 61 atcgaatcca ctgcgtcggt taaatttgaa tttagataaa taatgaactt gtagggaacc 121 gggcttccag ctgttttccg tcatcatcag atattaccca actcgacatt ccacataaac 181 agtgataaac tacagtgaag acaatgtcgg aggacaagca aattaaggag actgtggaaa 241 cggccttcaa acagcccgcc agggatgtgg acatatatcg cgacaccttc attcgctaca 301 tgggctacag caacgaaatc ggcgagtcct tccgcccact ggtgcccaaa tccttcgtgg 361 ccgcatccta tggcatggcc atcggttatg tctgcaccga taccttcgat aaggccctgc 421 gcctccaaat ggacggggca tcctccagag aggtggccat caagggcggc gacgtcttct 481 gctggcagat gctggcctcc gtcgccattc ccggcatggt catcaatcgg atcacctggg 541 ccaccaaaac tctgctcagt cgggcgccca tgcccgtgct gaaaacggtg cccactctgg 601 tgggcctggc cagcatcccg ctgatcatcc atcccatcga cagcctggtg gaccgcctga 661 tggacgccag ctaccgcaag ctggtgaggt agtgaacgct gcgcatgatc aactactcct 721 aatccccggt gatagaccct agatactaag agttcgcatt aactgtgttg caaagcttta 781 atcccaaaat ccagtttaca ccttgacgag gatttctaac tgta