Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii wings up A (wupA), transcript


LOCUS       XM_017155693            1264 bp    mRNA    linear   INV 09-DEC-2024
            variant X5, mRNA.
ACCESSION   XM_017155693
VERSION     XM_017155693.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155693.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1264
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1264
                     /gene="wupA"
                     /note="wings up A; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108066919"
     CDS             172..771
                     /gene="wupA"
                     /codon_start=1
                     /product="troponin I isoform X5"
                     /protein_id="XP_017011182.1"
                     /db_xref="GeneID:108066919"
                     /translation="MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERK
                     KKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEDTLKSLIKQHYDR
                     INKLEDQKYDLEYVVKRKDVEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKA
                     AEFNFRNQLKVVKKKEFTLEEEEKEKKIKDAAVLKQAKK"
     misc_feature    334..687
                     /gene="wupA"
                     /note="Region: Troponin; pfam00992"
                     /db_xref="CDD:460018"
     polyA_site      1264
                     /gene="wupA"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatctgtatc cgttggaagg ctggccgcta gaatatagtc tgccgtggat cgtcggaccg
       61 ttcagtcttt ttgtgtcgtt cagtatcatc cgattcgtgt gatcgacagc acagccgaat
      121 tttttttctt ttttttctaa ttccttgaag taaccaaaaa cacaaatcaa aatggctgat
      181 gatgaggcta agaaggctaa acaggctgag atcgagcgca agcgtgctga ggtgcgcaag
      241 cgcatggagg aagcctccaa ggccaagaag gccaagaagg gtttcatgac cccagagagg
      301 aagaagaaac tcaggttgct gctgcgtaag aaagccgctg aggagctgaa gaaagaacag
      361 gaacgcaaag cggctgaacg tagacgcatc attgaagaac gttgcggcag tcccaggaat
      421 ctcagcgatg ccagcgaaga cacactcaaa tctctgatca agcaacacta tgacaggatt
      481 aataaattgg aggaccagaa atatgatctt gagtatgttg ttaaacgcaa ggatgttgag
      541 atcaacgatc tcaatgccca agttaacgat cttcgcggca agttcgtcaa gccagccctg
      601 aagaaggtct ccaaatacga aaacaaattc gccaagctgc agaagaaggc cgctgagttc
      661 aacttccgca accagctcaa ggtggtgaag aagaaggagt tcacgctgga ggaggaggag
      721 aaggagaaaa agataaaaga tgccgctgtg ctaaagcaag ccaaaaagta agaaacccga
      781 ctggtccaag ggcaagcccg gagatgccaa ggtgaaggag gaggttgagg ccgaagctta
      841 agtgtccaca cgtccactag tgtccactga cccgtgactc ccgccctaaa caataattga
      901 aattatttac aacaattatc tgaagcaata caatttatat aaatctatta atatatatat
      961 atatccacaa atatatatgc atgtatatat ctcgccatat atatgtgttc acaatggatt
     1021 tgatcagaaa tgaagtcaat aaacaacaac agcaacaact aaaacaactc aaaatcaaaa
     1081 tcaaactcag actcaaactc aaactcaaga acaaaaacaa ctgctacaaa taattcagat
     1141 caacgattca aaacaacagc caaacatctg aacaccttga tgaattattg attatatttc
     1201 attatttaca aattatattt tttaatgtaa attaaattaa attacaaaaa aaaaagaaac
     1261 aaca