Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155692 1221 bp mRNA linear INV 09-DEC-2024 variant X3, mRNA. ACCESSION XM_017155692 VERSION XM_017155692.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155692.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1221 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1221 /gene="wupA" /note="wings up A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108066919" CDS 172..798 /gene="wupA" /codon_start=1 /product="troponin I isoform X3" /protein_id="XP_017011181.1" /db_xref="GeneID:108066919" /translation="MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERK KKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEAELQTICKQYWQR VYDLEGDKFDLEHVQKVKAQEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKA AEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKVKEEVEAEA" misc_feature 334..687 /gene="wupA" /note="Region: Troponin; pfam00992" /db_xref="CDD:460018" polyA_site 1221 /gene="wupA" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatctgtatc cgttggaagg ctggccgcta gaatatagtc tgccgtggat cgtcggaccg 61 ttcagtcttt ttgtgtcgtt cagtatcatc cgattcgtgt gatcgacagc acagccgaat 121 tttttttctt ttttttctaa ttccttgaag taaccaaaaa cacaaatcaa aatggctgat 181 gatgaggcta agaaggctaa acaggctgag atcgagcgca agcgtgctga ggtgcgcaag 241 cgcatggagg aagcctccaa ggccaagaag gccaagaagg gtttcatgac cccagagagg 301 aagaagaaac tcaggttgct gctgcgtaag aaagccgctg aggagctgaa gaaagaacag 361 gaacgcaaag cggctgaacg tagacgcatc attgaagaac gttgcggcag tcccaggaat 421 ctcagcgatg ccagcgaagc cgaactgcaa acaatatgca aacaatattg gcaacgcgtt 481 tacgatttgg agggcgataa gtttgattta gaacacgtgc agaaagtcaa ggcccaagag 541 atcaacgatc tcaatgccca agttaacgat cttcgcggca agttcgtcaa gccagccctg 601 aagaaggtct ccaaatacga aaacaaattc gccaagctgc agaagaaggc cgctgagttc 661 aacttccgca accagctcaa ggtggtgaag aagaaggagt tcacgctgga ggaggaggag 721 aaggagaaga aacccgactg gtccaagggc aagcccggag atgccaaggt gaaggaggag 781 gttgaggccg aagcttaagt gtccacacgt ccactagtgt ccactgaccc gtgactcccg 841 ccctaaacaa taattgaaat tatttacaac aattatctga agcaatacaa tttatataaa 901 tctattaata tatatatata tccacaaata tatatgcatg tatatatctc gccatatata 961 tgtgttcaca atggatttga tcagaaatga agtcaataaa caacaacagc aacaactaaa 1021 acaactcaaa atcaaaatca aactcagact caaactcaaa ctcaagaaca aaaacaactg 1081 ctacaaataa ttcagatcaa cgattcaaaa caacagccaa acatctgaac accttgatga 1141 attattgatt atatttcatt atttacaaat tatatttttt aatgtaaatt aaattaaatt 1201 acaaaaaaaa aagaaacaac a