Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017155686            1271 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066918), mRNA.
ACCESSION   XM_017155686
VERSION     XM_017155686.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155686.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1271
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1271
                     /gene="LOC108066918"
                     /note="uncharacterized LOC108066918; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066918"
     CDS             18..1271
                     /gene="LOC108066918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017011175.2"
                     /db_xref="GeneID:108066918"
                     /translation="MSDAVEEPPLYLTPQFFRRSLEHGLQQLELQVMGVQLTNLTRGG
                     ENYCSNIYRAQIRYRNAENCVLETSLIVKSMPDEKQAILARLHIYNKETIFYTTIKPK
                     LEALMWRASSSMDAWTLGAKHYYSTTQPEQTIIFEDLCSRGYQLKCRQLGLDFEHSAL
                     VMRKLAEYHAGTMVMGEREPETIVDRYPFGLLHMDAIKSEPFKLLFGTQLLKLAALVG
                     DCEGFGGITTKLYRYHEHFTERVLKAVYPLRGQHNVLNHGDLWVNNIFFKYDPNYKVQ
                     QVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELIEIYYQVLVDTLKQLPWSK
                     PLPSHEEVLEEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQKVQLM
                     FEGNTRTLESLKCTLKRLDELQLFD"
     misc_feature    144..1007
                     /gene="LOC108066918"
                     /note="Ecdysteroid kinase-like family; Region: EcKL;
                     pfam02958"
                     /db_xref="CDD:397213"
ORIGIN      
        1 cattccattg atctacgatg tcggacgccg tggaggagcc gccactttac ctgacccccc
       61 agttcttccg tcgcagcctg gagcacggat tgcagcagct ggagctgcag gtgatgggcg
      121 tccagctgac caacttgacc cgcggcgggg agaactactg cagcaacatc taccgggcgc
      181 agatcaggta tcgcaatgcg gagaactgcg tcctggagac gtccctgatc gtcaagtcca
      241 tgccggacga gaagcaggcc atcctggcgc gcctgcacat ctacaacaag gagaccatct
      301 tctacacgac catcaagccc aagttggagg cgctgatgtg gcgggccagc agttcgatgg
      361 atgcctggac tttgggcgcc aaacactact actccaccac ccagccggag cagacgatca
      421 tcttcgagga cctgtgctcc cggggctacc agctgaagtg ccgccagttg ggcctggact
      481 tcgagcactc ggcgctggtc atgcgcaaac tggccgaata ccatgcaggc accatggtga
      541 tgggcgaacg ggagccggag acgatcgttg atcggtatcc cttcggcctg ctccacatgg
      601 acgccatcaa gtcggagccc ttcaagctgc tcttcggcac tcagctgctg aagctggccg
      661 ccctggtggg cgactgcgag ggattcggcg ggataaccac gaagctctat cgctaccacg
      721 aacacttcac cgagcgcgtg ctcaaggcgg tctacccgct tcgcggccag cacaatgtcc
      781 tcaatcacgg ggacctttgg gtgaacaaca tattcttcaa gtacgatccg aactacaagg
      841 tgcagcaggt gaaaatcatt gacttccagc tgtgcttcta cggcagcctg ggcttcgaca
      901 taaactactt tttgaacacc agtttggagc tggaggtgct gcgtgaccgg cggcaggagc
      961 taatcgagat atactaccag gtgctggtgg acactttgaa gcagctgccg tggtcgaagc
     1021 cactgcccag ccacgaggag gtcctggaag agatcaggaa gcgcgaggcc tacggcttct
     1081 ttgtggcctt cggcttcttt ccgctgatga gcatgatcgg cgtggactcc gaggataact
     1141 cgctgaagaa cttccacgac gagacattcg ccaggcagaa ggtgcagctg atgttcgagg
     1201 gaaacactcg gacgctggag agcctaaaat gcaccctcaa gcgtttggat gagctgcagc
     1261 tctttgacta a