Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155686 1271 bp mRNA linear INV 09-DEC-2024 (LOC108066918), mRNA. ACCESSION XM_017155686 VERSION XM_017155686.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155686.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1271 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1271 /gene="LOC108066918" /note="uncharacterized LOC108066918; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066918" CDS 18..1271 /gene="LOC108066918" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017011175.2" /db_xref="GeneID:108066918" /translation="MSDAVEEPPLYLTPQFFRRSLEHGLQQLELQVMGVQLTNLTRGG ENYCSNIYRAQIRYRNAENCVLETSLIVKSMPDEKQAILARLHIYNKETIFYTTIKPK LEALMWRASSSMDAWTLGAKHYYSTTQPEQTIIFEDLCSRGYQLKCRQLGLDFEHSAL VMRKLAEYHAGTMVMGEREPETIVDRYPFGLLHMDAIKSEPFKLLFGTQLLKLAALVG DCEGFGGITTKLYRYHEHFTERVLKAVYPLRGQHNVLNHGDLWVNNIFFKYDPNYKVQ QVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELIEIYYQVLVDTLKQLPWSK PLPSHEEVLEEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQKVQLM FEGNTRTLESLKCTLKRLDELQLFD" misc_feature 144..1007 /gene="LOC108066918" /note="Ecdysteroid kinase-like family; Region: EcKL; pfam02958" /db_xref="CDD:397213" ORIGIN 1 cattccattg atctacgatg tcggacgccg tggaggagcc gccactttac ctgacccccc 61 agttcttccg tcgcagcctg gagcacggat tgcagcagct ggagctgcag gtgatgggcg 121 tccagctgac caacttgacc cgcggcgggg agaactactg cagcaacatc taccgggcgc 181 agatcaggta tcgcaatgcg gagaactgcg tcctggagac gtccctgatc gtcaagtcca 241 tgccggacga gaagcaggcc atcctggcgc gcctgcacat ctacaacaag gagaccatct 301 tctacacgac catcaagccc aagttggagg cgctgatgtg gcgggccagc agttcgatgg 361 atgcctggac tttgggcgcc aaacactact actccaccac ccagccggag cagacgatca 421 tcttcgagga cctgtgctcc cggggctacc agctgaagtg ccgccagttg ggcctggact 481 tcgagcactc ggcgctggtc atgcgcaaac tggccgaata ccatgcaggc accatggtga 541 tgggcgaacg ggagccggag acgatcgttg atcggtatcc cttcggcctg ctccacatgg 601 acgccatcaa gtcggagccc ttcaagctgc tcttcggcac tcagctgctg aagctggccg 661 ccctggtggg cgactgcgag ggattcggcg ggataaccac gaagctctat cgctaccacg 721 aacacttcac cgagcgcgtg ctcaaggcgg tctacccgct tcgcggccag cacaatgtcc 781 tcaatcacgg ggacctttgg gtgaacaaca tattcttcaa gtacgatccg aactacaagg 841 tgcagcaggt gaaaatcatt gacttccagc tgtgcttcta cggcagcctg ggcttcgaca 901 taaactactt tttgaacacc agtttggagc tggaggtgct gcgtgaccgg cggcaggagc 961 taatcgagat atactaccag gtgctggtgg acactttgaa gcagctgccg tggtcgaagc 1021 cactgcccag ccacgaggag gtcctggaag agatcaggaa gcgcgaggcc tacggcttct 1081 ttgtggcctt cggcttcttt ccgctgatga gcatgatcgg cgtggactcc gaggataact 1141 cgctgaagaa cttccacgac gagacattcg ccaggcagaa ggtgcagctg atgttcgagg 1201 gaaacactcg gacgctggag agcctaaaat gcaccctcaa gcgtttggat gagctgcagc 1261 tctttgacta a