Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii cytoplasmic 60S subunit biogenesis


LOCUS       XM_017155685            1416 bp    mRNA    linear   INV 09-DEC-2024
            factor ZNF622 (LOC108066917), mRNA.
ACCESSION   XM_017155685
VERSION     XM_017155685.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155685.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1416
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1416
                     /gene="LOC108066917"
                     /note="cytoplasmic 60S subunit biogenesis factor ZNF622;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108066917"
     CDS             104..1333
                     /gene="LOC108066917"
                     /codon_start=1
                     /product="cytoplasmic 60S subunit biogenesis factor
                     ZNF622"
                     /protein_id="XP_017011174.1"
                     /db_xref="GeneID:108066917"
                     /translation="MSHFTCLNCDARFASADVQRDHYKTDWHRYNLKRRVAQLPPVTA
                     EEFQQRVLSARSATDAALEEQQLSVYCQACRRQFGGQKAHDNHLNSRKHKELLARFER
                     DQMMASGGSASTASASVCTRSVLEPRPHPALAAAAAGKGRLAFAERAAKADEDQEMDE
                     DDDDFEDIEEEEVDSDEWDKIPENPLTERDCLFCSHESEDLVENLKHMSVAHSFFIPD
                     TEYCTDIEGLLYYLGEKVANYFICLFCNDRGKTFYSLDAVRKHMVDKGHCQMLHEGVA
                     LAEYAEYYDYSSSYPDNKEGMDIDDEVVPELLDGDEYQLVLPSGAVIGHRSLLRYYRQ
                     HLRPERAVVLQKSDRKLHRVLSEYRALGWTHTQQLSAARKARDIHLMKRVQSKWQMKL
                     GCKANKLQKHYRAQVLI"
     misc_feature    <119..244
                     /gene="LOC108066917"
                     /note="hypothetical protein; Provisional; Region:
                     PTZ00448"
                     /db_xref="CDD:185627"
     misc_feature    119..187
                     /gene="LOC108066917"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275371"
     misc_feature    order(140..148,152..157,167..169,182..184,329..331,
                     338..352,356..361)
                     /gene="LOC108066917"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275371"
     misc_feature    311..385
                     /gene="LOC108066917"
                     /note="Zinc-finger double-stranded RNA-binding; Region:
                     zf-C2H2_jaz; pfam12171"
                     /db_xref="CDD:432381"
     misc_feature    314..382
                     /gene="LOC108066917"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275371"
     misc_feature    674..973
                     /gene="LOC108066917"
                     /note="C2H2 type zinc-finger (2 copies); Region:
                     zf-C2H2_2; pfam12756"
                     /db_xref="CDD:463690"
     polyA_site      1416
                     /gene="LOC108066917"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccgagaacgt ggttctgtta atcatcttta cttgtgaaat acgccattcc aattcgattc
       61 gaaaccgata aaaacaaaac tctaaaccaa atcaacagca ggaatgtcgc actttacctg
      121 cctgaactgc gatgcccgct tcgccagcgc ggatgtgcag cgggatcact acaagaccga
      181 ctggcatcgc tacaacctga agcgcagggt ggcccagctg cccccggtca cggcggagga
      241 gttccagcag cgcgtgctga gcgcccgcag tgccacggat gcggcgctgg aggagcagca
      301 gctgagcgtc tactgccagg cctgcaggag gcagtttggt ggccagaagg cccacgacaa
      361 tcacctgaac agccgcaagc acaaggagct cctcgcccgc ttcgagcggg atcagatgat
      421 ggccagcggt ggcagcgcca gtaccgcctc cgcttccgtt tgcacgcgca gcgtcctcga
      481 gccacgcccc catcccgccc tggccgccgc cgccgctggc aagggtcgtc tggcctttgc
      541 ggagcgagcc gccaaggcgg atgaggacca ggagatggac gaagacgacg acgacttcga
      601 ggacatcgag gaggaggagg tggactccga tgagtgggac aagatacccg agaatccgct
      661 gacggagcgc gactgcctgt tctgctcaca cgagagcgag gatctggtgg agaacctgaa
      721 gcacatgtcc gtggcccact cgttcttcat cccagacaca gaatactgca ccgacatcga
      781 gggactgctc tactacctgg gcgagaaggt ggccaactac ttcatctgcc tgttctgcaa
      841 cgatcgcggc aagaccttct actccctgga cgcggtgcgc aagcacatgg tcgacaaggg
      901 ccactgccag atgctccacg agggcgtggc gctggccgag tatgccgagt actacgacta
      961 cagcagcagt tacccagata ataaagaagg catggacatt gatgacgagg tggtgcccga
     1021 gctgctagac ggcgatgagt accagttggt gctgccatcc ggggcagtca ttggccatcg
     1081 gtccctgctc cgctactacc gccagcatct ccggccggaa cgcgctgtgg tcctccagaa
     1141 gtccgaccgc aaactgcatc gcgtgctcag cgaatatcgt gctctcggct ggacgcacac
     1201 ccaacagctc tctgccgctc gcaaggcacg cgacattcat ctgatgaagc gcgtccagtc
     1261 caagtggcag atgaagctcg gctgcaaggc caacaagctg cagaagcact atcgcgccca
     1321 ggttctgata taaatcgttg ttttctctcc atttcctttt taaaaagcta tatctaaatc
     1381 cattgtacaa taaaaacgaa ttgaattttg cttaaa