PREDICTED: Drosophila takahashii Peptidoglycan recognition protein

LOCUS       XM_017155676            1169 bp    mRNA    linear   INV 09-DEC-2024
            SA (PGRP-SA), mRNA.
ACCESSION   XM_017155676
VERSION     XM_017155676.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155676.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1169
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1169
                     /gene="PGRP-SA"
                     /note="Peptidoglycan recognition protein SA; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108066914"
     CDS             429..1025
                     /gene="PGRP-SA"
                     /codon_start=1
                     /product="peptidoglycan-recognition protein SA"
                     /protein_id="XP_017011165.2"
                     /db_xref="GeneID:108066914"
                     /translation="MFPARLLTLLGLLVISVAVSAGKPRHQAAANCPTIKLKRQWGGK
                     PSLGLHYQVRPIRFVVIHHTVTSECSGLLKCAEILQNMQSYHQNELDYNDISYNFLIG
                     SDGIVYEGTGWGLRGAHTYGYNGNGTGIAFIGNFVDKLPTDAALQAAKSLLACGVQQG
                     ELSEDYALIAGSQVISTQSPGLTLYNEIQEWPHWLSNP"
     misc_feature    525..950
                     /gene="PGRP-SA"
                     /note="Animal peptidoglycan recognition proteins
                     homologous to Bacteriophage T3 lysozyme; Region: PGRP;
                     smart00701"
                     /db_xref="CDD:128941"
     misc_feature    order(612..614,717..719,939..941,957..959,963..965)
                     /gene="PGRP-SA"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    order(612..614,939..941,963..965)
                     /gene="PGRP-SA"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    order(615..620,705..707,717..719,759..761,780..785,
                     798..800,939..941,951..953,957..965)
                     /gene="PGRP-SA"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
ORIGIN      
        1 aaagctcaac aaacttttcc tctgactcag cgccacctga gtggagagtg catagagtgg
       61 gtgaaggcga aagagagtgc actgcaagaa ataaatatga gttagtgttg aatttgaaaa
      121 gttttgcatt cgtcactatc tggagatcgg aaatgccaac acagatcggt ttgcaacctg
      181 ttttaaatgg ttgtttggac tttttgcttg tcgctctttg aaggtgggta cggaaaaaaa
      241 agaaccgaac aaagaacgct gggatcgaac gatcttaatg agatcgggag atggtcaggg
      301 agtcccctgt ggggatcgta agctctgcaa taaatcgcaa aagctcggat cgccggcggt
      361 gatacaaata aatccgagtg ataagccacc gagagcagtt ctcatccggc attagatctt
      421 agcacaccat gtttcccgct cgcttgctta cgcttctggg gcttctggta atctctgtgg
      481 ccgtctccgc cggaaagccg cgtcatcaag ccgctgccaa ttgtccgacc atcaagctga
      541 aacgccaatg gggcggcaag ccatcgctgg gcctccacta ccaagtgcgt cccatccgct
      601 ttgtggtcat ccatcacacg gtcaccagcg agtgcagcgg actgctcaag tgcgccgaga
      661 tcctgcagaa catgcagagc tatcatcaga acgagctgga ttacaatgat atcagttaca
      721 acttcctgat cggcagcgat ggcatcgttt acgagggcac cggctgggga ctgcggggag
      781 cccacaccta cggctacaat ggcaacggca cgggaatcgc ctttatcggt aactttgtgg
      841 ataaacttcc aacggacgcc gctctgcagg cggccaagag tctcctggcc tgcggcgtcc
      901 agcaggggga gctgagcgag gattacgccc tgatcgcggg ctcccaggtg atcagcaccc
      961 agagtcccgg actaacgctg tacaacgaga tccaggagtg gccgcactgg ctctcgaatc
     1021 cttgagagca attagaaatc tagaaaaact tgtaaaacct gtaaaactcg atcaacgatt
     1081 ggcggtttaa cagttagctt tcctgccacg tgcactattt atcgatctat cggcgtacac
     1141 tgaaaataat ttttggttag catcaaaaa