PREDICTED: Drosophila takahashii translocase of inner membrane 8

LOCUS       XM_017155619             688 bp    mRNA    linear   INV 09-DEC-2024
            (Tim8), mRNA.
ACCESSION   XM_017155619
VERSION     XM_017155619.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155619.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..688
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..688
                     /gene="Tim8"
                     /note="translocase of inner membrane 8; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108066894"
     CDS             126..392
                     /gene="Tim8"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit Tim8"
                     /protein_id="XP_017011108.1"
                     /db_xref="GeneID:108066894"
                     /translation="MSEFENLSGNDKELQEFLMIEKQKAQVNAQIHEFNEICWEKCIG
                     KPSTKLDHATETCLSNCVDRFIDTSLLITQRFAQMLQKRGGGDL"
     misc_feature    171..359
                     /gene="Tim8"
                     /note="Tim10/DDP family zinc finger; Region: zf-Tim10_DDP;
                     pfam02953"
                     /db_xref="CDD:460764"
     polyA_site      688
                     /gene="Tim8"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attcgacgtt agccaacact acgcaccagc tgtccgaatt tatataacct aaaaatcaac
       61 cttaaaactc tagaaattcc ccggctaatt cgtagattgt tcactgaaaa ccagaaaaac
      121 caacaatgtc cgagtttgag aatctatctg gaaacgacaa ggagctgcag gagttcctca
      181 tgatcgagaa gcagaaggcc caggtgaacg cgcagattca cgaattcaac gagatctgct
      241 gggagaagtg catcgggaag ccgagcacca agctggacca cgccaccgag acgtgtttga
      301 gcaactgcgt cgaccgattt atcgacacct cgctgctgat cacccagcgc ttcgcccaaa
      361 tgctccaaaa acgcggcggc ggcgatttgt aaaaggggca aatcttctgg gaatccgggg
      421 aatctgggga tctggaaatc cggggaatcc gattatccgg ggagcttccg ccaccaccac
      481 tgtcctactg ttaaagctac ttttaaacaa aaacaaatta tcatgtaagc accttttttt
      541 tccgcggcca tctgattttc ggatgtttcc ggccctctgg acaaggaaaa accacaaata
      601 tcctgtacca taactctact gttttgacgg cccgacgcta gcgaatccaa aataaataca
      661 acctttcgtt ttgtatgtta aaaatgaa