Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Uroporphyrinogen III synthase 1


LOCUS       XM_017155614            1594 bp    mRNA    linear   INV 09-DEC-2024
            (Uros1), mRNA.
ACCESSION   XM_017155614
VERSION     XM_017155614.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155614.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1594
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1594
                     /gene="Uros1"
                     /note="Uroporphyrinogen III synthase 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108066888"
     CDS             201..1034
                     /gene="Uros1"
                     /codon_start=1
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="XP_017011103.2"
                     /db_xref="GeneID:108066888"
                     /translation="MTSRQRTVIIFKSESESSDLYAETLEKHDFQPVFVPTLSFGFKN
                     LEELRGKLQNPDKYAGIIFTSPRCVEAVAESLNLGQLPGGWKMLHNYAVGEVTHNLAT
                     STLDQLFTHGKQTGNARALGEFIVDTFDGSRELPLLLPCGNLATDTLLSKLAENGFSV
                     DACEVYETRCHPELGANVERALEAYGESIEFLAFFSPSGVNCAQQYFASRQMSLDKWK
                     LVAIGPSTRRALESQGLKVYCTAERPTVEHLVKVLLNPQDSRERLLKERERLAALENN
                     N"
     misc_feature    order(234..236,393..401,486..488,624..626,696..698,
                     702..704,783..797)
                     /gene="Uros1"
                     /note="active site"
                     /db_xref="CDD:119440"
     misc_feature    261..953
                     /gene="Uros1"
                     /note="Uroporphyrinogen-III synthase HemD; Region: HEM4;
                     pfam02602"
                     /db_xref="CDD:426866"
     polyA_site      1594
                     /gene="Uros1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tggattgtgc actcgctaag aggacaagtt ttgtgttcta ttaaaattac aagtaaatat
       61 cagctgattc ttgagttttc tatttatttt tgggccacag aaaggcgcag gcgaaggcga
      121 aggcggcgga ggcggcaagt aaccgagtag aaaataagca aaatccaaaa acagaagcag
      181 tgcagagcca gcaaaacacg atgacgagtc gccagcggac ggtgataata ttcaaatcgg
      241 agtcggagag cagcgatttg tatgcggaaa cgctggagaa gcacgacttc cagccggtct
      301 ttgtgcccac gctgagtttt ggcttcaaga atctggagga gctgcgcggg aagctccaga
      361 atccggacaa atatgccggc ataatattta catcgccgcg ttgcgtggag gcggtggcgg
      421 aatccctgaa tttgggtcaa ctaccaggcg gttggaagat gttgcataac tatgcggtgg
      481 gcgaggtgac ccacaatctg gccacgagca ccttggacca gctattcacc cacggcaagc
      541 agacgggaaa tgcccgggcc ctcggcgagt tcattgtgga caccttcgat ggatcgagag
      601 agctgccgct tttgctgccc tgcggcaatt tggccaccga tacgctgctc tcgaagctgg
      661 ccgagaatgg cttctccgtg gacgcctgcg aggtctacga gacgcgctgc cacccggaac
      721 tgggtgccaa tgtggagcga gctttggagg cgtatggcga atcgattgag ttcctggcct
      781 tcttctcgcc atcgggcgtc aattgcgccc agcagtactt cgccagccgg cagatgtcgt
      841 tggacaaatg gaagctggtg gccattggac cgagcacccg gcgcgccttg gaatcgcagg
      901 gactgaaggt ctactgcacc gccgagcggc cgacggtgga gcatctggtg aaggtgctgc
      961 tgaatccaca ggacagccgg gagcggctgc tcaaggagcg cgagcggttg gccgccctcg
     1021 agaataacaa ttaagatgtg tagtcctaag gatttagcta tgtcatctag aaaccataat
     1081 ggtgatgtta aggccggaaa tttgttaaaa ccccctcgaa gatattgtaa acctaagatc
     1141 tataatattt ataaagagat cttaaggtct ttgcatggcc tttgattttg cccaaaattt
     1201 ctagttaata ttttatgatt tatccctaac tttattctaa gatcctaaat tattggaatt
     1261 gaaatttgtt aaaaccccct cgaagatatt gtaaacctaa gatctattat ttttatctag
     1321 agatcttaag gcctctgtat acttttgatt ttgcccaaga tctttagttg aataatttta
     1381 tatccaaatt attggaattt gcggtgggaa aatcgcagga taagtaatac tacgttcccc
     1441 gaatgacaaa tgtaacgaaa aaagactaca actcttgagt ttttttcgac tgacctccga
     1501 gcgagtacaa aattagcggg catcaaatgc cgacgtcttt attttctgtt taccattgga
     1561 ttaggctcaa taaattgttt cttttctaaa ttta