PREDICTED: Drosophila takahashii fibrinogen-like protein 1

LOCUS       XM_017155598            1042 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066878), mRNA.
ACCESSION   XM_017155598
VERSION     XM_017155598.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155598.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1042
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1042
                     /gene="LOC108066878"
                     /note="fibrinogen-like protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066878"
     CDS             116..1042
                     /gene="LOC108066878"
                     /codon_start=1
                     /product="fibrinogen-like protein 1"
                     /protein_id="XP_017011087.2"
                     /db_xref="GeneID:108066878"
                     /translation="MRAPLIAFFLLILISWVSSNEIFKPRQNVENPCSEHRIWRPILD
                     RFVKVNASEELKSQVNAMAETIKDLQSQIVEKTQEIKDQSARVRVLTANIKHLRAEVK
                     NKDKQITEINGDLLKCSPKNPQLNSSTGWLTIQKRFDGTENFDRSWRDYKDGFGNPKG
                     EFFIGLEKIHLMTRERPHELYINLGKIDGSTGYAHYDDFRIGSEQESFELQSLGLYEG
                     TAGDSLRLHEHQKFTTLDRDNDSYRLNCAADEYGGWWYYNCAQSMLNGKFYKEGHSRD
                     NKTNGILWGSWHNNDWTQSLTFVEMMIRPKTL"
     misc_feature    116..>460
                     /gene="LOC108066878"
                     /note="Septal ring factor EnvC, activator of murein
                     hydrolases AmiA and AmiB [Cell cycle control, cell
                     division, chromosome partitioning]; Region: EnvC; COG4942"
                     /db_xref="CDD:443969"
     misc_feature    503..1033
                     /gene="LOC108066878"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    740..742
                     /gene="LOC108066878"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(827..829,833..835,839..841)
                     /gene="LOC108066878"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(851..853,860..865,890..895)
                     /gene="LOC108066878"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
ORIGIN      
        1 tgtttttaat tttaatgcct ttttgaggcg cttacttata agaatcaaaa tcaaatttaa
       61 cgaaattcag tttacttttc ggttgcagtt gccacagttc gccaatttca gcgaaatgag
      121 agcgccattg attgccttct ttctgttgat tttgatatcc tgggtatcct caaatgaaat
      181 cttcaaacct cgtcaaaatg ttgaaaatcc ctgcagtgaa catcgaattt ggcggcccat
      241 tctcgatcga ttcgtaaagg ttaatgccag cgaggagctg aaaagccaag tgaatgctat
      301 ggcagagacc atcaaggatt tgcagagtca gatagtggaa aaaacccagg aaatcaagga
      361 tcaaagtgcc agagttcgag ttttgacggc aaatataaaa cacttgcggg ccgaagtgaa
      421 aaacaaagat aaacagatca cagaaataaa cggcgatctc ttgaagtgca gtcccaaaaa
      481 tccccaactt aatagttcaa ccggttggtt aactattcaa aaacgttttg acggaaccga
      541 gaatttcgat cgatcctggc gggattacaa agacggtttc ggcaatccaa aaggagaatt
      601 tttcatcggg ctggagaaaa ttcacctcat gactcgtgaa cgaccacacg aactgtatat
      661 aaatctgggc aagattgatg gttccacggg atacgctcat tacgacgact ttaggatcgg
      721 aagtgagcag gaatcgtttg agctgcaatc gctgggcctc tacgaaggca ccgctggcga
      781 ttcgctgaga ctccatgagc accagaagtt caccacactc gacagggata atgattccta
      841 tcgtctgaat tgcgctgccg acgagtacgg tggctggtgg tactacaact gcgcccagag
      901 catgctcaat ggaaagtttt acaaagaggg acactctagg gataataaaa cgaatggaat
      961 tttatggggt tcctggcaca acaacgattg gacccaatcg cttacttttg tggaaatgat
     1021 gataaggcct aaaacattgt aa