Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017155315             692 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066696), mRNA.
ACCESSION   XM_017155315
VERSION     XM_017155315.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155315.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..692
                     /gene="LOC108066696"
                     /note="uncharacterized LOC108066696; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066696"
     CDS             115..618
                     /gene="LOC108066696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017010804.2"
                     /db_xref="GeneID:108066696"
                     /translation="MVLNMTRGNLAHLIYGTALLTAISVTPLVTLESRLGYPKRINSA
                     KFFYPNILGPAIVSLVLTILTMVPRLMNPNRWHKENKGFFLLMLPWILFCCLKFAHNF
                     ELLSKTTVHVWDEEVWMNLMVLLLVAYCLIFCLALEQMLSWCTIYLMMTDDMITWRLY
                     LERRLME"
ORIGIN      
        1 aacttcaaaa gaactccata tacgaaacga ataactacta aattccgtcg tcgtgctcag
       61 taattattgt gatttattta agcagttata atttggtttc ttgcagttgt gattatggtc
      121 ctaaatatga ctcgtgggaa cctggcgcat ctgatctacg gaacggcgct tctaacggcg
      181 atcagtgtga ctcctttggt caccttggaa tcacgcttgg gttaccctaa gcgcataaac
      241 agcgcaaagt tcttctatcc gaatatcctg ggccccgcca ttgtgtccct ggtgctgacc
      301 atcctgacaa tggtgccccg cctgatgaac ccgaatcgct ggcacaagga aaataagggg
      361 ttcttcctac tgatgctgcc ctggatcctg ttctgctgcc tcaagttcgc ccataacttc
      421 gaactgctgt ccaagacaac cgtacatgtg tgggatgagg aagtctggat gaacctaatg
      481 gtccttctcc tcgtcgccta ctgtcttatc ttctgtttgg ccctggaaca gatgctctcc
      541 tggtgcacga tctaccttat gatgaccgat gatatgatca cctggcggct ttacctggag
      601 agaaggctta tggagtaatt gtttactaat tgatgcgcat tacgactctt aagcttgatg
      661 tgtatgccaa ataatattaa tgcattccaa aa