Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155315 692 bp mRNA linear INV 09-DEC-2024 (LOC108066696), mRNA. ACCESSION XM_017155315 VERSION XM_017155315.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155315.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..692 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..692 /gene="LOC108066696" /note="uncharacterized LOC108066696; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066696" CDS 115..618 /gene="LOC108066696" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017010804.2" /db_xref="GeneID:108066696" /translation="MVLNMTRGNLAHLIYGTALLTAISVTPLVTLESRLGYPKRINSA KFFYPNILGPAIVSLVLTILTMVPRLMNPNRWHKENKGFFLLMLPWILFCCLKFAHNF ELLSKTTVHVWDEEVWMNLMVLLLVAYCLIFCLALEQMLSWCTIYLMMTDDMITWRLY LERRLME" ORIGIN 1 aacttcaaaa gaactccata tacgaaacga ataactacta aattccgtcg tcgtgctcag 61 taattattgt gatttattta agcagttata atttggtttc ttgcagttgt gattatggtc 121 ctaaatatga ctcgtgggaa cctggcgcat ctgatctacg gaacggcgct tctaacggcg 181 atcagtgtga ctcctttggt caccttggaa tcacgcttgg gttaccctaa gcgcataaac 241 agcgcaaagt tcttctatcc gaatatcctg ggccccgcca ttgtgtccct ggtgctgacc 301 atcctgacaa tggtgccccg cctgatgaac ccgaatcgct ggcacaagga aaataagggg 361 ttcttcctac tgatgctgcc ctggatcctg ttctgctgcc tcaagttcgc ccataacttc 421 gaactgctgt ccaagacaac cgtacatgtg tgggatgagg aagtctggat gaacctaatg 481 gtccttctcc tcgtcgccta ctgtcttatc ttctgtttgg ccctggaaca gatgctctcc 541 tggtgcacga tctaccttat gatgaccgat gatatgatca cctggcggct ttacctggag 601 agaaggctta tggagtaatt gtttactaat tgatgcgcat tacgactctt aagcttgatg 661 tgtatgccaa ataatattaa tgcattccaa aa