Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii salivary glue protein Sgs-3


LOCUS       XM_017155313            1108 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066695), mRNA.
ACCESSION   XM_017155313
VERSION     XM_017155313.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155313.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1108
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1108
                     /gene="LOC108066695"
                     /note="salivary glue protein Sgs-3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066695"
     CDS             109..942
                     /gene="LOC108066695"
                     /codon_start=1
                     /product="salivary glue protein Sgs-3"
                     /protein_id="XP_017010802.2"
                     /db_xref="GeneID:108066695"
                     /translation="MRVYHLLLITFGLAAIAGTRGVLAHPPRQEPDPCITTTTCTPPP
                     PCTTTTCTPEPPCTTTTCTPEPPCTTTTCTPPPCTTTTCTPPPCTPPPCTTTTCTPPP
                     CTPPPCTTTTCTPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPCTRTPPCTR
                     TPPCTTTTTCTPPCTTTEPCPPNNPLNPGNNGTNVVGDTEHDINGVAKVASVLISRHD
                     CRGEEDGTFLADVRHCRRYYICQRQRSRRVSCPSGFWFDRELKTCRLASLVDNCDARR
                     N"
     misc_feature    763..924
                     /gene="LOC108066695"
                     /note="Chitin binding Peritrophin-A domain; Region:
                     CBM_14; pfam01607"
                     /db_xref="CDD:426342"
     polyA_site      1108
                     /gene="LOC108066695"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccccactgcg gagcgatata aaaagcgacc cgattgaagc gaaaaacatt cgtcatccgg
       61 cagagaagta gaaactgcag tagcacaagc accatcgtcg aacgcaacat gagagtttac
      121 cacttgctgc tgattacatt cggtctggcc gcgatcgccg gcacccgggg agttctggcc
      181 catccaccta ggcaagaacc ggatccgtgc atcaccacca ccacctgtac cccaccgcct
      241 ccatgcacca ccaccacctg caccccggag ccaccgtgca ccaccaccac ctgtaccccg
      301 gagccaccgt gcaccaccac cacctgcacc ccgcctccat gcacgaccac cacctgcacc
      361 ccacctccgt gcaccccacc tccatgcacc accaccacct gtacccctcc tccatgcaca
      421 ccaccgccat gcaccaccac cacctgtacc cctccgccgt gcaccaggac cccaccaccg
      481 tgcactagga ctccaccacc ctgcaccagg accccaccac catgcaccag gaccccgccg
      541 ccgtgcacca ggactcctcc atgcaccagg acgccaccct gcacccggac tccaccctgc
      601 accacgacta caacctgcac cccaccttgc accaccaccg aaccttgccc acccaataac
      661 ccgctgaatc ccggaaacaa tggaaccaac gtggttggag acacggaaca cgacatcaat
      721 ggtgtcgcca aagttgcctc ggtgctgatc tcgcgccacg attgccgtgg cgaggaggat
      781 ggcaccttcc tggccgatgt gcgtcactgc cgccgctact acatttgcca acggcagagg
      841 tcgaggcgcg tgtcctgccc cagcggcttc tggttcgatc gcgagctgaa gacctgccgt
      901 ctggccagcc tcgtcgacaa ctgtgacgcc aggcgcaact aagcagtgcg ccagtgtggc
      961 catcgtgcgc ccaagcaaag caaattggtt ttacagaatt tttttttgca ctttttcaaa
     1021 gaatatatag cacagcaaga gtgtgcggat taattgttaa cgattccaaa gcaataaata
     1081 aatatttcac tgattataca agaaacaa