Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155313 1108 bp mRNA linear INV 09-DEC-2024 (LOC108066695), mRNA. ACCESSION XM_017155313 VERSION XM_017155313.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155313.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1108 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1108 /gene="LOC108066695" /note="salivary glue protein Sgs-3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066695" CDS 109..942 /gene="LOC108066695" /codon_start=1 /product="salivary glue protein Sgs-3" /protein_id="XP_017010802.2" /db_xref="GeneID:108066695" /translation="MRVYHLLLITFGLAAIAGTRGVLAHPPRQEPDPCITTTTCTPPP PCTTTTCTPEPPCTTTTCTPEPPCTTTTCTPPPCTTTTCTPPPCTPPPCTTTTCTPPP CTPPPCTTTTCTPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPPCTRTPPCTRTPPCTR TPPCTTTTTCTPPCTTTEPCPPNNPLNPGNNGTNVVGDTEHDINGVAKVASVLISRHD CRGEEDGTFLADVRHCRRYYICQRQRSRRVSCPSGFWFDRELKTCRLASLVDNCDARR N" misc_feature 763..924 /gene="LOC108066695" /note="Chitin binding Peritrophin-A domain; Region: CBM_14; pfam01607" /db_xref="CDD:426342" polyA_site 1108 /gene="LOC108066695" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccccactgcg gagcgatata aaaagcgacc cgattgaagc gaaaaacatt cgtcatccgg 61 cagagaagta gaaactgcag tagcacaagc accatcgtcg aacgcaacat gagagtttac 121 cacttgctgc tgattacatt cggtctggcc gcgatcgccg gcacccgggg agttctggcc 181 catccaccta ggcaagaacc ggatccgtgc atcaccacca ccacctgtac cccaccgcct 241 ccatgcacca ccaccacctg caccccggag ccaccgtgca ccaccaccac ctgtaccccg 301 gagccaccgt gcaccaccac cacctgcacc ccgcctccat gcacgaccac cacctgcacc 361 ccacctccgt gcaccccacc tccatgcacc accaccacct gtacccctcc tccatgcaca 421 ccaccgccat gcaccaccac cacctgtacc cctccgccgt gcaccaggac cccaccaccg 481 tgcactagga ctccaccacc ctgcaccagg accccaccac catgcaccag gaccccgccg 541 ccgtgcacca ggactcctcc atgcaccagg acgccaccct gcacccggac tccaccctgc 601 accacgacta caacctgcac cccaccttgc accaccaccg aaccttgccc acccaataac 661 ccgctgaatc ccggaaacaa tggaaccaac gtggttggag acacggaaca cgacatcaat 721 ggtgtcgcca aagttgcctc ggtgctgatc tcgcgccacg attgccgtgg cgaggaggat 781 ggcaccttcc tggccgatgt gcgtcactgc cgccgctact acatttgcca acggcagagg 841 tcgaggcgcg tgtcctgccc cagcggcttc tggttcgatc gcgagctgaa gacctgccgt 901 ctggccagcc tcgtcgacaa ctgtgacgcc aggcgcaact aagcagtgcg ccagtgtggc 961 catcgtgcgc ccaagcaaag caaattggtt ttacagaatt tttttttgca ctttttcaaa 1021 gaatatatag cacagcaaga gtgtgcggat taattgttaa cgattccaaa gcaataaata 1081 aatatttcac tgattataca agaaacaa