Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155281 840 bp mRNA linear INV 09-DEC-2024 (LOC108066680), mRNA. ACCESSION XM_017155281 VERSION XM_017155281.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017155281.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..840 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..840 /gene="LOC108066680" /note="uncharacterized LOC108066680; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066680" CDS 1..840 /gene="LOC108066680" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017010770.2" /db_xref="GeneID:108066680" /translation="MPSSQFHLLLLLLLGTLILVAGQKPTFRVPPQDLQVPNFGGESF ERFASGAGSGSASVSSSGSSASQETSDEMREQLKQLLSDQLANAFAPLATTPFTQRQP AIASPASGAAARSQFAADPDQDQNEEESPEAEAEAEEEEGDEEEEQETTTLQPQPSPP PLPQPGGAEEELAGGQVEVDDYNAWRDNFYDLNEDGSYIFGYSIPHGVRRWEKGFYSE GQHGQVVEGFYVQPRHDSQGLRYELRCYRADSNGYQPLPVEFLRTPPIVRRDEVPQVN CFR" misc_feature 592..759 /gene="LOC108066680" /note="Insect cuticle protein; Region: Chitin_bind_4; pfam00379" /db_xref="CDD:459790" ORIGIN 1 atgccatcga gtcagtttca cctgctgctg ctgctgctgc tcggcacctt gatcctggtc 61 gctggccaaa agccaacctt tcgagtgccg ccgcaggatc tgcaggtgcc caacttcggg 121 ggcgagagct tcgagagatt cgccagcggt gcgggatcgg gatcggcatc ggtgtcgagt 181 agcgggagca gcgcgagcca ggaaaccagc gatgagatgc gggagcaact gaagcagctc 241 ctcagcgacc aactggccaa tgccttcgcc cccctggcca ccacgccctt cacccagcga 301 caaccggcca ttgcgtcacc cgcctcgggg gcagcagctc gttcccagtt cgccgccgat 361 ccggatcagg atcagaatga agaggagtcc cccgaggcgg aggcggaggc ggaggaggag 421 gagggcgacg aagaggagga gcaggagacc actactctcc agccgcagcc atcgcctcca 481 ccacttccac aaccaggagg cgccgaggag gagttggctg gtggccaagt ggaggtggac 541 gactataatg cctggcgcga taatttctat gacctcaacg aggacggcag ctatatcttt 601 ggttactcca ttcctcatgg cgttcgtcgc tgggagaagg gtttctattc agaaggtcag 661 catggtcagg tggtcgaggg cttctacgtg cagccccgcc acgattccca gggcctaaga 721 tacgagttgc ggtgctacag agccgattct aatggttacc agccactgcc agtggagttc 781 ctgaggacgc cgccaattgt gaggcgcgat gaggtgcccc aggtgaattg cttccgatga