Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017155281             840 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066680), mRNA.
ACCESSION   XM_017155281
VERSION     XM_017155281.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017155281.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..840
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..840
                     /gene="LOC108066680"
                     /note="uncharacterized LOC108066680; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066680"
     CDS             1..840
                     /gene="LOC108066680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017010770.2"
                     /db_xref="GeneID:108066680"
                     /translation="MPSSQFHLLLLLLLGTLILVAGQKPTFRVPPQDLQVPNFGGESF
                     ERFASGAGSGSASVSSSGSSASQETSDEMREQLKQLLSDQLANAFAPLATTPFTQRQP
                     AIASPASGAAARSQFAADPDQDQNEEESPEAEAEAEEEEGDEEEEQETTTLQPQPSPP
                     PLPQPGGAEEELAGGQVEVDDYNAWRDNFYDLNEDGSYIFGYSIPHGVRRWEKGFYSE
                     GQHGQVVEGFYVQPRHDSQGLRYELRCYRADSNGYQPLPVEFLRTPPIVRRDEVPQVN
                     CFR"
     misc_feature    592..759
                     /gene="LOC108066680"
                     /note="Insect cuticle protein; Region: Chitin_bind_4;
                     pfam00379"
                     /db_xref="CDD:459790"
ORIGIN      
        1 atgccatcga gtcagtttca cctgctgctg ctgctgctgc tcggcacctt gatcctggtc
       61 gctggccaaa agccaacctt tcgagtgccg ccgcaggatc tgcaggtgcc caacttcggg
      121 ggcgagagct tcgagagatt cgccagcggt gcgggatcgg gatcggcatc ggtgtcgagt
      181 agcgggagca gcgcgagcca ggaaaccagc gatgagatgc gggagcaact gaagcagctc
      241 ctcagcgacc aactggccaa tgccttcgcc cccctggcca ccacgccctt cacccagcga
      301 caaccggcca ttgcgtcacc cgcctcgggg gcagcagctc gttcccagtt cgccgccgat
      361 ccggatcagg atcagaatga agaggagtcc cccgaggcgg aggcggaggc ggaggaggag
      421 gagggcgacg aagaggagga gcaggagacc actactctcc agccgcagcc atcgcctcca
      481 ccacttccac aaccaggagg cgccgaggag gagttggctg gtggccaagt ggaggtggac
      541 gactataatg cctggcgcga taatttctat gacctcaacg aggacggcag ctatatcttt
      601 ggttactcca ttcctcatgg cgttcgtcgc tgggagaagg gtttctattc agaaggtcag
      661 catggtcagg tggtcgaggg cttctacgtg cagccccgcc acgattccca gggcctaaga
      721 tacgagttgc ggtgctacag agccgattct aatggttacc agccactgcc agtggagttc
      781 ctgaggacgc cgccaattgt gaggcgcgat gaggtgcccc aggtgaattg cttccgatga