Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cuticular protein 12A (Cpr12A),


LOCUS       XM_017155278             657 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017155278
VERSION     XM_017155278.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017155278.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..657
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..657
                     /gene="Cpr12A"
                     /note="Cuticular protein 12A; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066677"
     CDS             72..608
                     /gene="Cpr12A"
                     /codon_start=1
                     /product="larval cuticle protein 16/17"
                     /protein_id="XP_017010767.3"
                     /db_xref="GeneID:108066677"
                     /translation="MATSDLILLSIFLLSATVTHLTSAQQIRESNEKERSVRLLDRFD
                     NRYPDGSYEYRFELDDGTARYERGYFAKINDVKTLMVVGYYAYRMTDGRYITVFYNAD
                     QFGYRQNQSITPQEYPNLPRSIEVPMASDSDSVSNSQSQSQSRLESHGNPSPSPSPSA
                     TTTTTTPRGAGTSRRGRY"
     misc_feature    225..389
                     /gene="Cpr12A"
                     /note="Insect cuticle protein; Region: Chitin_bind_4;
                     pfam00379"
                     /db_xref="CDD:459790"
ORIGIN      
        1 gcgacagcac acaacacccc acatacccca tatacccatc catccataac tcacatagcc
       61 cgcaaataaa aatggccact tccgatctga tcctgctctc cattttcctc ctgagcgcca
      121 ccgtcaccca cctcacatcc gcccagcaga tcagggaaag taacgaaaag gagcggagcg
      181 tgcgattgct ggatcgattc gataaccgat atcccgacgg aagttacgag tatcgattcg
      241 agctggacga cggaacggcg cgttacgagc gcggatattt tgccaagatc aacgatgtga
      301 agaccctcat ggtcgtgggc tactacgcgt atcggatgac cgacgggcga tacatcaccg
      361 tgttctataa cgccgatcaa tttggctatc ggcagaatca gtcgatcacg ccgcaagagt
      421 atcccaacct gccgcgctcc atcgaggtgc ccatggccag cgattctgat tccgtttcca
      481 attcccaatc gcaatcccaa tcccggctgg agtcccatgg aaacccctcc ccctccccct
      541 ccccctccgc gacgacgacg acgacaacgc cccggggggc ggggacgagt cgcaggggcc
      601 gctactgaga gcccgtaatt gcacaccatc ctcattatta ttatggctcc ctccatc