Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155278 657 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017155278 VERSION XM_017155278.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017155278.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..657 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..657 /gene="Cpr12A" /note="Cuticular protein 12A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066677" CDS 72..608 /gene="Cpr12A" /codon_start=1 /product="larval cuticle protein 16/17" /protein_id="XP_017010767.3" /db_xref="GeneID:108066677" /translation="MATSDLILLSIFLLSATVTHLTSAQQIRESNEKERSVRLLDRFD NRYPDGSYEYRFELDDGTARYERGYFAKINDVKTLMVVGYYAYRMTDGRYITVFYNAD QFGYRQNQSITPQEYPNLPRSIEVPMASDSDSVSNSQSQSQSRLESHGNPSPSPSPSA TTTTTTPRGAGTSRRGRY" misc_feature 225..389 /gene="Cpr12A" /note="Insect cuticle protein; Region: Chitin_bind_4; pfam00379" /db_xref="CDD:459790" ORIGIN 1 gcgacagcac acaacacccc acatacccca tatacccatc catccataac tcacatagcc 61 cgcaaataaa aatggccact tccgatctga tcctgctctc cattttcctc ctgagcgcca 121 ccgtcaccca cctcacatcc gcccagcaga tcagggaaag taacgaaaag gagcggagcg 181 tgcgattgct ggatcgattc gataaccgat atcccgacgg aagttacgag tatcgattcg 241 agctggacga cggaacggcg cgttacgagc gcggatattt tgccaagatc aacgatgtga 301 agaccctcat ggtcgtgggc tactacgcgt atcggatgac cgacgggcga tacatcaccg 361 tgttctataa cgccgatcaa tttggctatc ggcagaatca gtcgatcacg ccgcaagagt 421 atcccaacct gccgcgctcc atcgaggtgc ccatggccag cgattctgat tccgtttcca 481 attcccaatc gcaatcccaa tcccggctgg agtcccatgg aaacccctcc ccctccccct 541 ccccctccgc gacgacgacg acgacaacgc cccggggggc ggggacgagt cgcaggggcc 601 gctactgaga gcccgtaatt gcacaccatc ctcattatta ttatggctcc ctccatc