PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017155273             519 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066673), mRNA.
ACCESSION   XM_017155273
VERSION     XM_017155273.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017155273.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..519
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..519
                     /gene="LOC108066673"
                     /note="uncharacterized LOC108066673; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066673"
     CDS             1..519
                     /gene="LOC108066673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017010762.2"
                     /db_xref="GeneID:108066673"
                     /translation="MIWFLAIMLIVIQIKRGNMGQMLYGTALLTAVSLTPSVTLEVPL
                     NYSKGSPSVVFRYPNVLITALASLALTILAMLPSLLIPKRWRRQKRCYLPLLPWILVC
                     CIKFATNMELFYKAIYHVWHGGHPESLVFALCVYCAISSLALDQMLRWNVMYHLMTND
                     ITKLRIYLNLFG"
ORIGIN      
        1 atgatttggt tccttgctat tatgctaatt gtcatccaaa ttaaacgcgg caacatgggc
       61 cagatgctct acggaacggc gcttctcacg gcggtcagtt tgaccccgag tgtcacgctg
      121 gaggtgccct tgaattactc taagggatcg ccgtccgtag tgttccgcta cccgaatgtc
      181 ctgatcaccg ccctcgcgtc cctggcgctg accatcctgg ccatgctgcc ctcgctgctg
      241 atcccgaaac gctggcgtcg gcagaagaga tgctacctgc cgttgctgcc ctggatcctg
      301 gtctgctgca tcaaattcgc caccaatatg gagctgttct ataaggcgat ctaccatgtg
      361 tggcatggtg gccatccgga gtcattggtc ttcgcccttt gcgtctactg tgccatttcc
      421 agcttggccc tggaccagat gctccgctgg aacgtcatgt accatctgat gaccaacgat
      481 attaccaagt tacgcattta cctaaacctt tttggttag