Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017155272 921 bp mRNA linear INV 09-DEC-2024 (LOC108066672), mRNA. ACCESSION XM_017155272 VERSION XM_017155272.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017155272.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..921 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..921 /gene="LOC108066672" /note="uncharacterized LOC108066672; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108066672" CDS 1..921 /gene="LOC108066672" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017010761.2" /db_xref="GeneID:108066672" /translation="MASKLSLIVFMAIIAVGLALTTPTTVRTREPMPTTTEKPKSSGV ETVESMERRDKRQLTANGGQSSLAGSSGQFPIFFDGLNVNPPLQPLPLPPLQPLQPIT VVTPVASNSNAQSQQPQSGWLPGFGQNLPIIGTWVGGLPNLISGLGLGGLNGGFGTLG GLNLGNLGLGAVSPVAPAPVASSPNSQASCPLTQKLSCRCEPLIQLPGLKPISNPLRT QLVQILRQNARKNDDGSQEVRVILSSGHVLYQKITRDLGQSGYLAMRIQSGRYFNIYY SVNEKEYTVRADVKDTPPTSDFDDELSGQL" ORIGIN 1 atggccagca aactgagttt aatcgtcttt atggctatca tagctgtggg actggcctta 61 accacaccaa caacagtaag aaccagggaa cccatgccca ctacaactga aaagcccaag 121 agtagtggtg tggagaccgt ggagtcaatg gaacgccggg acaaacgaca attgactgcc 181 aatggtggcc agagcagcct ggctggttcc agtggccaat ttcccatttt cttcgacggc 241 ctaaatgtga accccccgct gcagccgctg ccactgccgc ccctgcagcc cctgcagccg 301 attaccgtgg tgacgcccgt ggcctccaac tcgaatgccc agagtcagca gccgcagtcc 361 ggctggctgc ccggctttgg ccagaatctg cccataatcg gcacctgggt cggcgggctg 421 cccaatctga tcagcggttt gggtctgggc ggtctgaacg gcggcttcgg caccctgggt 481 ggcctcaatc tgggcaacct gggactgggc gctgtatcgc ccgtggcccc ggctcccgtc 541 gcctcgtccc ccaattccca ggccagctgt ccgctcaccc agaagctgag ctgccgctgt 601 gagccgctca tccagctgcc gggtctgaag cccatttcga atcctttgag aacccagctg 661 gtgcagatcc tgcggcagaa tgcccgcaaa aacgacgatg gctcgcaaga ggtgcgggtg 721 atcctgagca gtggccatgt gttgtaccag aagatcacca gggatctcgg acagagcggc 781 tatttagcca tgaggatcca gtcgggcagg tacttcaaca tctactacag tgtcaacgag 841 aaggagtaca ctgtgcgggc ggatgtgaag gacacgccac ccacctccga tttcgacgac 901 gaactgagcg gtcagcttta a