Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017155272             921 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066672), mRNA.
ACCESSION   XM_017155272
VERSION     XM_017155272.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017155272.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..921
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..921
                     /gene="LOC108066672"
                     /note="uncharacterized LOC108066672; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108066672"
     CDS             1..921
                     /gene="LOC108066672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017010761.2"
                     /db_xref="GeneID:108066672"
                     /translation="MASKLSLIVFMAIIAVGLALTTPTTVRTREPMPTTTEKPKSSGV
                     ETVESMERRDKRQLTANGGQSSLAGSSGQFPIFFDGLNVNPPLQPLPLPPLQPLQPIT
                     VVTPVASNSNAQSQQPQSGWLPGFGQNLPIIGTWVGGLPNLISGLGLGGLNGGFGTLG
                     GLNLGNLGLGAVSPVAPAPVASSPNSQASCPLTQKLSCRCEPLIQLPGLKPISNPLRT
                     QLVQILRQNARKNDDGSQEVRVILSSGHVLYQKITRDLGQSGYLAMRIQSGRYFNIYY
                     SVNEKEYTVRADVKDTPPTSDFDDELSGQL"
ORIGIN      
        1 atggccagca aactgagttt aatcgtcttt atggctatca tagctgtggg actggcctta
       61 accacaccaa caacagtaag aaccagggaa cccatgccca ctacaactga aaagcccaag
      121 agtagtggtg tggagaccgt ggagtcaatg gaacgccggg acaaacgaca attgactgcc
      181 aatggtggcc agagcagcct ggctggttcc agtggccaat ttcccatttt cttcgacggc
      241 ctaaatgtga accccccgct gcagccgctg ccactgccgc ccctgcagcc cctgcagccg
      301 attaccgtgg tgacgcccgt ggcctccaac tcgaatgccc agagtcagca gccgcagtcc
      361 ggctggctgc ccggctttgg ccagaatctg cccataatcg gcacctgggt cggcgggctg
      421 cccaatctga tcagcggttt gggtctgggc ggtctgaacg gcggcttcgg caccctgggt
      481 ggcctcaatc tgggcaacct gggactgggc gctgtatcgc ccgtggcccc ggctcccgtc
      541 gcctcgtccc ccaattccca ggccagctgt ccgctcaccc agaagctgag ctgccgctgt
      601 gagccgctca tccagctgcc gggtctgaag cccatttcga atcctttgag aacccagctg
      661 gtgcagatcc tgcggcagaa tgcccgcaaa aacgacgatg gctcgcaaga ggtgcgggtg
      721 atcctgagca gtggccatgt gttgtaccag aagatcacca gggatctcgg acagagcggc
      781 tatttagcca tgaggatcca gtcgggcagg tacttcaaca tctactacag tgtcaacgag
      841 aaggagtaca ctgtgcgggc ggatgtgaag gacacgccac ccacctccga tttcgacgac
      901 gaactgagcg gtcagcttta a