Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii PDGF- and VEGF-related factor 1


LOCUS       XM_017154402            1846 bp    mRNA    linear   INV 09-DEC-2024
            (Pvf1), transcript variant X1, mRNA.
ACCESSION   XM_017154402
VERSION     XM_017154402.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017154402.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1846
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1846
                     /gene="Pvf1"
                     /note="PDGF- and VEGF-related factor 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:108066057"
     CDS             361..1335
                     /gene="Pvf1"
                     /codon_start=1
                     /product="uncharacterized protein Pvf1"
                     /protein_id="XP_017009891.2"
                     /db_xref="GeneID:108066057"
                     /translation="MAMSRTRSRIFKPVVVPPLLLLLLIVGRAAGANLVSPNHRLPSQ
                     RFFYADTAISASSSQTKVRLLRQADDPNAAPEAVEGSCCQGAAAEAGKPLTIPLTVSA
                     ELTNVTVDYDVSGEIPSSKENFKRSISKSTVRNATPASCSPQPTIVELKPPAEDEANY
                     YYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSGRRPFTIITVEQHT
                     QCRCDCRTKAEDCNVYQSYRKDLCRCECHNTDARDKCLEQAENKYWVDDNCTCVCRYN
                     QSCTTGTVFDETQCKCTDPGAPINVLDRKRFIVQAVQVDPDNTTLYSV"
     misc_feature    775..1035
                     /gene="Pvf1"
                     /note="Platelet-derived and vascular endothelial growth
                     factors (PDGF, VEGF) family domain; PDGF is a potent
                     activator for cells of mesenchymal origin; PDGF-A and
                     PDGF-B form AA and BB homodimers and an AB heterodimer;
                     VEGF is a potent mitogen in embryonic and...; Region:
                     PDGF; cd00135"
                     /db_xref="CDD:238079"
     misc_feature    order(775..786,886..888,892..903,946..957)
                     /gene="Pvf1"
                     /note="receptor binding interface [active]"
                     /db_xref="CDD:238079"
     misc_feature    order(781..783,874..876,886..888,907..909,1018..1020,
                     1024..1026)
                     /gene="Pvf1"
                     /note="cysteine knot motif; other site"
                     /db_xref="CDD:238079"
     misc_feature    order(856..858,883..885)
                     /gene="Pvf1"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238079"
     polyA_site      1846
                     /gene="Pvf1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ggcacaggca cagtaacttg gcccacaccg acgacacgac agttttgaac ggaacttgct
       61 ggtgcttgga tcgcagttca gatccgatcc gatccgatct ccgcgaagtt ggcacattac
      121 cgattttgat tccgccgtcg acgcgctcaa atatatatca caaaatatta aacattattc
      181 gtgctttttt ttcttgtttt ccgttgagtt taaccgattt gtgagtggtg atccctctgt
      241 ataattatat aaaggatttt gttaaagtga ttccttgatt tttgagacgt tttcgcatcg
      301 aataattgga acagtttttg tgtcatcagc cgtaattcgg agctatttta agaggatcga
      361 atggccatgt cccgaacccg aagcagaata ttcaaacctg tggtggttcc accgcttctt
      421 ttgctcctcc tgatcgtcgg cagagcagcg ggtgcaaatc ttgtatcccc aaaccacaga
      481 ctaccatcgc agaggttctt ctacgccgac actgcgatct ccgcctcctc ctcgcagacc
      541 aaggtgcgac tgctccgcca ggcggatgac ccgaatgctg cgccggaggc agtggagggc
      601 agctgctgcc agggagcagc cgccgaagcc ggaaaaccac tgacgattcc actgaccgtg
      661 tccgctgagt tgaccaacgt gactgtggat tatgatgttt ccggcgagat cccctcctcg
      721 aaggaaaact tcaagcgcag catctcaaaa tccaccgtga ggaatgcgac gccggccagc
      781 tgctcgccgc agcccacgat cgtggagctg aagccgccgg cggaggacga ggctaactac
      841 tactacatgc ccgcctgcac gcggatcagt cggtgcaacg gctgctgcgg ctccacgctg
      901 atctcctgcc agccgacgga ggtggagcag gtgcagctgc gggtgcgcaa ggtggacagg
      961 gcggcgacca gcggacgccg gccgttcacc atcatcaccg tggagcagca cacgcagtgc
     1021 cgctgcgatt gccgaacgaa ggcggaggac tgcaatgtgt atcagtcgta ccgcaaggac
     1081 ctgtgccgct gcgagtgcca caacacggat gcgcgggaca agtgcctgga gcaggccgag
     1141 aacaagtact gggtggacga caactgcacc tgcgtgtgcc gctacaacca gagctgcacc
     1201 accggcaccg tcttcgatga gacgcagtgc aagtgcaccg accctggcgc acccatcaat
     1261 gttttggacc gcaaacgctt cattgtccag gccgtacagg tggaccccga taacaccacc
     1321 ctgtacagtg tttgagtaca gttaacaaac accggggagt acgaaggaga aacgccagct
     1381 tcctagaggg aaatccccga gtactgagaa agcaattacc gaagaattgc actaagcgta
     1441 gttgcctatg tactttaaat tatttatagt tatcgattaa acatagccta agaccactgt
     1501 acccccttaa aaactaactc acagtatttt ccccttgctt ctgcggcaca aaaaacaaga
     1561 aaaagggggt ttgcaaaaat ctctaacgat tggatgtaac ttgaaaatgt gtttaaaact
     1621 ggacaaacta tacaattttg gatacatttt ctaaaaaatt ccaaaataga aatttttgcg
     1681 caacccctgc gtaaatatta attttattaa tttgttaata gtacttttta agcgccttcc
     1741 actttgtcgc ggccttgtat acacttgttt atttccgttt gtttaagttt taattcattc
     1801 taaattaatc gtccacaaat taaatgctat ccaataattc gctgta