Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017154402 1846 bp mRNA linear INV 09-DEC-2024 (Pvf1), transcript variant X1, mRNA. ACCESSION XM_017154402 VERSION XM_017154402.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017154402.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1846 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1846 /gene="Pvf1" /note="PDGF- and VEGF-related factor 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:108066057" CDS 361..1335 /gene="Pvf1" /codon_start=1 /product="uncharacterized protein Pvf1" /protein_id="XP_017009891.2" /db_xref="GeneID:108066057" /translation="MAMSRTRSRIFKPVVVPPLLLLLLIVGRAAGANLVSPNHRLPSQ RFFYADTAISASSSQTKVRLLRQADDPNAAPEAVEGSCCQGAAAEAGKPLTIPLTVSA ELTNVTVDYDVSGEIPSSKENFKRSISKSTVRNATPASCSPQPTIVELKPPAEDEANY YYMPACTRISRCNGCCGSTLISCQPTEVEQVQLRVRKVDRAATSGRRPFTIITVEQHT QCRCDCRTKAEDCNVYQSYRKDLCRCECHNTDARDKCLEQAENKYWVDDNCTCVCRYN QSCTTGTVFDETQCKCTDPGAPINVLDRKRFIVQAVQVDPDNTTLYSV" misc_feature 775..1035 /gene="Pvf1" /note="Platelet-derived and vascular endothelial growth factors (PDGF, VEGF) family domain; PDGF is a potent activator for cells of mesenchymal origin; PDGF-A and PDGF-B form AA and BB homodimers and an AB heterodimer; VEGF is a potent mitogen in embryonic and...; Region: PDGF; cd00135" /db_xref="CDD:238079" misc_feature order(775..786,886..888,892..903,946..957) /gene="Pvf1" /note="receptor binding interface [active]" /db_xref="CDD:238079" misc_feature order(781..783,874..876,886..888,907..909,1018..1020, 1024..1026) /gene="Pvf1" /note="cysteine knot motif; other site" /db_xref="CDD:238079" misc_feature order(856..858,883..885) /gene="Pvf1" /note="dimerization interface [polypeptide binding]; other site" /db_xref="CDD:238079" polyA_site 1846 /gene="Pvf1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ggcacaggca cagtaacttg gcccacaccg acgacacgac agttttgaac ggaacttgct 61 ggtgcttgga tcgcagttca gatccgatcc gatccgatct ccgcgaagtt ggcacattac 121 cgattttgat tccgccgtcg acgcgctcaa atatatatca caaaatatta aacattattc 181 gtgctttttt ttcttgtttt ccgttgagtt taaccgattt gtgagtggtg atccctctgt 241 ataattatat aaaggatttt gttaaagtga ttccttgatt tttgagacgt tttcgcatcg 301 aataattgga acagtttttg tgtcatcagc cgtaattcgg agctatttta agaggatcga 361 atggccatgt cccgaacccg aagcagaata ttcaaacctg tggtggttcc accgcttctt 421 ttgctcctcc tgatcgtcgg cagagcagcg ggtgcaaatc ttgtatcccc aaaccacaga 481 ctaccatcgc agaggttctt ctacgccgac actgcgatct ccgcctcctc ctcgcagacc 541 aaggtgcgac tgctccgcca ggcggatgac ccgaatgctg cgccggaggc agtggagggc 601 agctgctgcc agggagcagc cgccgaagcc ggaaaaccac tgacgattcc actgaccgtg 661 tccgctgagt tgaccaacgt gactgtggat tatgatgttt ccggcgagat cccctcctcg 721 aaggaaaact tcaagcgcag catctcaaaa tccaccgtga ggaatgcgac gccggccagc 781 tgctcgccgc agcccacgat cgtggagctg aagccgccgg cggaggacga ggctaactac 841 tactacatgc ccgcctgcac gcggatcagt cggtgcaacg gctgctgcgg ctccacgctg 901 atctcctgcc agccgacgga ggtggagcag gtgcagctgc gggtgcgcaa ggtggacagg 961 gcggcgacca gcggacgccg gccgttcacc atcatcaccg tggagcagca cacgcagtgc 1021 cgctgcgatt gccgaacgaa ggcggaggac tgcaatgtgt atcagtcgta ccgcaaggac 1081 ctgtgccgct gcgagtgcca caacacggat gcgcgggaca agtgcctgga gcaggccgag 1141 aacaagtact gggtggacga caactgcacc tgcgtgtgcc gctacaacca gagctgcacc 1201 accggcaccg tcttcgatga gacgcagtgc aagtgcaccg accctggcgc acccatcaat 1261 gttttggacc gcaaacgctt cattgtccag gccgtacagg tggaccccga taacaccacc 1321 ctgtacagtg tttgagtaca gttaacaaac accggggagt acgaaggaga aacgccagct 1381 tcctagaggg aaatccccga gtactgagaa agcaattacc gaagaattgc actaagcgta 1441 gttgcctatg tactttaaat tatttatagt tatcgattaa acatagccta agaccactgt 1501 acccccttaa aaactaactc acagtatttt ccccttgctt ctgcggcaca aaaaacaaga 1561 aaaagggggt ttgcaaaaat ctctaacgat tggatgtaac ttgaaaatgt gtttaaaact 1621 ggacaaacta tacaattttg gatacatttt ctaaaaaatt ccaaaataga aatttttgcg 1681 caacccctgc gtaaatatta attttattaa tttgttaata gtacttttta agcgccttcc 1741 actttgtcgc ggccttgtat acacttgttt atttccgttt gtttaagttt taattcattc 1801 taaattaatc gtccacaaat taaatgctat ccaataattc gctgta