PREDICTED: Drosophila takahashii L-xylulose reductase

LOCUS       XM_017154350             884 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108066031), mRNA.
ACCESSION   XM_017154350
VERSION     XM_017154350.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017154350.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..884
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..884
                     /gene="LOC108066031"
                     /note="L-xylulose reductase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108066031"
     CDS             108..836
                     /gene="LOC108066031"
                     /codon_start=1
                     /product="L-xylulose reductase"
                     /protein_id="XP_017009839.1"
                     /db_xref="GeneID:108066031"
                     /translation="MWADLAGKVILVTGAGAGIGQALVKQLATAGATVIAVARKAEQL
                     EELVAFDPVHIQPLQLDLSGWQAVREGLAKVPLLDGLVNNAGVAVIKPFEELTEQDFD
                     VHFDVNIKAVFNVTQSLLPRLRDGASVVNVSSIASSRSFGGHTAYSATKAALDSLTKS
                     LALELGPRRIRVNSVNPTVVLTKMGADNWSDPAKSGPLLAHIPLNRFCEVQEVVDATG
                     YLLSSKSSFVNGHHILLEGGYSVS"
     misc_feature    108..833
                     /gene="LOC108066031"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(147..149,153..158,162..164,219..227,357..365,
                     501..509,546..548,558..560,636..647)
                     /gene="LOC108066031"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187609"
     misc_feature    order(429..431,507..509,546..548,558..560)
                     /gene="LOC108066031"
                     /note="active site"
                     /db_xref="CDD:187609"
     polyA_site      884
                     /gene="LOC108066031"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atttccagtt cagttcttcc agcgatcccc ttgcactcgg aacggaactt tccacccggg
       61 cagaatatag atttatagat ttaaagtagc aatccgatcc aatcaccatg tgggccgatc
      121 ttgcgggcaa ggtgatcttg gtgaccggtg ccggagccgg aattggacag gccctggtca
      181 agcagctggc cacggcggga gccaccgtca tcgcggtggc caggaaggcg gagcagctgg
      241 aggagctggt ggccttcgat ccggtgcaca tccagccgct ccagttggac ctcagcgggt
      301 ggcaggcggt gcgcgagggc ctggcgaagg ttcccctgct ggacggactg gtgaacaacg
      361 ccggagtggc ggttattaag ccgttcgagg agctcactga acaggatttc gatgtccact
      421 ttgatgtgaa catcaaggcg gtgttcaatg tcacgcagtc gctgctgccg cgcctcagag
      481 acggcgcctc cgttgtcaac gtatcctcga tagcttcgag ccgatccttt ggcgggcaca
      541 cagcctacag tgccaccaag gcggccctgg actcgctgac caagtcgctg gccttggaat
      601 tgggtccgcg aaggatccgg gtgaattccg tcaatcccac cgtggtgctg accaaaatgg
      661 gcgccgacaa ttggtcggat cccgccaaga gtggaccgct gttggctcac attccgttaa
      721 atcggttctg cgaggtccag gaggtggtcg atgccaccgg ttatctgctg agcagcaagt
      781 ccagcttcgt taacggccac cacatcctcc tggagggagg ttactccgtt tcctaagaat
      841 caatccgaaa ttcaatcaaa ttaaaaacaa agcctggact aaaa