Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Thioredoxin T (TrxT), mRNA.


LOCUS       XM_017153877            1111 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017153877
VERSION     XM_017153877.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153877.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1111
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1111
                     /gene="TrxT"
                     /note="Thioredoxin T; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 8 Proteins"
                     /db_xref="GeneID:108065741"
     CDS             164..643
                     /gene="TrxT"
                     /codon_start=1
                     /product="thioredoxin-T"
                     /protein_id="XP_017009366.2"
                     /db_xref="GeneID:108065741"
                     /translation="MVYLVRNKEDLDQQLALAEDKLVVIDFYANWCGPCKIIAPKLEE
                     LAELYSDRAVVLKVNVDENEDITLDYNVTSMPTFVFIKAGEVLELFVGGNPDKLAKSM
                     EKYVDDVAADVEATEQRGLPGSEDACSAGPSASSSGSVNDVVISELEEHDQEAVLDH"
     misc_feature    221..481
                     /gene="TrxT"
                     /note="The thioredoxin (TRX)-like superfamily is a large,
                     diverse group of proteins containing a TRX fold. Many
                     members contain a classic TRX domain with a redox active
                     CXXC motif. They function as protein disulfide
                     oxidoreductases (PDOs), altering the redox...; Region:
                     Protein Disulfide Oxidoreductases and Other Proteins with
                     a Thioredoxin fold; cl00388"
                     /db_xref="CDD:469754"
     misc_feature    order(257..259,266..268)
                     /gene="TrxT"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     polyA_site      1111
                     /gene="TrxT"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcaatccacc ccggatgaca tttaaaaatt gtttttgggt ccaagtaggc ttgttccaat
       61 gaattttgtc ttccttatta attgacggat cccagctcgt tcatttcggc ctgatatttc
      121 gctgtgagca gtcgttccgc tcccaaattt ccaaattaaa atcatggtgt acctggtgag
      181 gaacaaggaa gatctcgacc agcagctggc cctcgccgag gacaagctgg tggtgatcga
      241 tttctatgcc aactggtgcg gtccgtgcaa gattatagcc ccaaaactgg aggagctggc
      301 cgagctgtat tcggaccggg cggttgtgct caaggtgaat gtggacgaga acgaggacat
      361 cacgctggac tacaatgtga ccagcatgcc gacctttgtc ttcatcaagg ccggcgaggt
      421 cctggagctc ttcgttggcg gcaatccgga taagctggcc aagtccatgg agaagtatgt
      481 cgacgatgtg gcggcggatg tggaggccac cgagcagcga ggactgccgg gatccgagga
      541 tgcgtgcagt gccgggccaa gtgcctcctc cagtggcagt gtcaacgatg tggtcatcag
      601 cgagctggag gagcacgacc aggaggccgt cttggaccac taataccgaa ataatgccgt
      661 tcaaaatagc ctcatagctt cgagttcctg ttacaaacaa gccaacacaa cacccgatat
      721 cccgagagaa aaacacaccc tactgatgat gatgcttgta aatgttataa gattgatgtc
      781 atggaggacc tgggaccttc ctcaagcaaa actcctcgtc aacactacac atccaaatac
      841 ttccaagtgg tcgccatcat tgtaatctta taacattgac aatatgctgc gcacacgaat
      901 tatccttaaa tattctacat gctatctcaa tctaaactaa tttgaaatat gtacgaccga
      961 catagctgct caattttcaa aacattgctg gtttcttgtt aacactacac aaacaaatga
     1021 tgatattgtt gccgaacaca aagacaagaa caaatattta ccagtaaaaa atggaaaaat
     1081 ggaataaagg gtctgaaaac tgaaaataga a