PREDICTED: Drosophila takahashii U1 small nuclear ribonucleoprotein

LOCUS       XM_017153876             853 bp    mRNA    linear   INV 09-DEC-2024
            A snf (snf), mRNA.
ACCESSION   XM_017153876
VERSION     XM_017153876.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153876.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..853
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..853
                     /gene="snf"
                     /note="U1 small nuclear ribonucleoprotein A snf; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108065740"
     CDS             101..751
                     /gene="snf"
                     /codon_start=1
                     /product="U1 small nuclear ribonucleoprotein A"
                     /protein_id="XP_017009365.1"
                     /db_xref="GeneID:108065740"
                     /translation="MDVRPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALK
                     TLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKLKGTFKERP
                     KKIKPPKPAPGAEEKKDKKKKPTSAENSNPNTQTEQPPNQILFLTNLPEETNEMMLSM
                     LFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK"
     misc_feature    101..355
                     /gene="snf"
                     /note="RNA recognition motif 1 (RRM1) found in Drosophila
                     melanogaster sex determination protein SNF and similar
                     proteins; Region: RRM1_SNF; cd12476"
                     /db_xref="CDD:409905"
     misc_feature    order(128..130,134..139,146..148,221..223,227..229,
                     233..241,245..253,257..259,329..331,338..340,344..355)
                     /gene="snf"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:409905"
     misc_feature    509..748
                     /gene="snf"
                     /note="RNA recognition motif 2 (RRM2) found in Drosophila
                     melanogaster sex determination protein SNF and similar
                     proteins; Region: RRM2_SNF; cd12479"
                     /db_xref="CDD:240923"
     polyA_site      853
                     /gene="snf"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atagtttgcc atccctagct agaaagcatt tttttttact cgaaaaaaac tataaaactt
       61 gcttgttttt gtggatttaa ttgattaaaa ggacggcagg atggacgtgc gacccaacca
      121 gacgatatat atcaacaacc tgaatgagaa gatcaagaag gaggagctga agaagtcgct
      181 ctacgcgatt ttctcgcagt tcggccaaat cctggacatt gtggcactga agaccctgaa
      241 aatgcgcggc caggcatttg tgatcttcaa ggaaatcggt agcgcctcga atgccctgcg
      301 caccatgcag ggattcccct tctacgacaa gcccatgcag atagcctact ccaagtcgga
      361 ctcggatatt gtggccaagc tgaagggaac cttcaaggag cgccccaaga agatcaagcc
      421 accgaaaccg gcgccaggtg ccgaggaaaa gaaggacaag aaaaagaagc cgaccagcgc
      481 ggagaactcg aacccgaaca cacaaacgga gcagccgccc aaccagatcc tcttcctcac
      541 caatctgccc gaggagacca acgagatgat gctgtccatg ctgttcaacc agttccccgg
      601 cttcaaggag gtgcgtctcg tgccgaatcg ccacgacatc gccttcgtgg agttcaccac
      661 ggagctgcaa agtaatgccg ccaaggaggc gctgcagggc ttcaagatca cgccgacgca
      721 cgccatgaag atcaccttcg ccaagaagtg agcccagcgc ctacacggac tctaggtgta
      781 aacgtcgctg gctggaggtt caagccactc catttataat ttaaagtata gaataaatca
      841 atatatacat aca