Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cuticular protein 5C (Cpr5C),


LOCUS       XM_017153874             579 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017153874
VERSION     XM_017153874.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153874.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..579
                     /gene="Cpr5C"
                     /note="Cuticular protein 5C; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:108065739"
     CDS             57..509
                     /gene="Cpr5C"
                     /codon_start=1
                     /product="larval cuticle protein A2B"
                     /protein_id="XP_017009363.2"
                     /db_xref="GeneID:108065739"
                     /translation="MAFKFVALLALIAAASAGVLPAAQVYHAAPVATYAAHAPAAAVL
                     KTVAHPVLAKADEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDSDG
                     FKRTVQYTADPINGFNAVVNREPLVKTVVKTVAPVAPVYAAPAAIYHH"
     misc_feature    249..407
                     /gene="Cpr5C"
                     /note="Insect cuticle protein; Region: Chitin_bind_4;
                     pfam00379"
                     /db_xref="CDD:459790"
ORIGIN      
        1 cagcgttcag ttaactaaca tctctcgact ttcagtcttc aaatcaagct cctaaaatgg
       61 cattcaagtt tgtggccctc ctcgccctga tcgccgctgc cagtgccggt gtcctgcccg
      121 ccgcccaggt gtaccatgcc gctccggtgg ccacctatgc ggctcatgcc cctgccgccg
      181 ccgtcctgaa gaccgtggcc catccggtgc tggccaaggc cgacgaggag tacgatcccc
      241 atccgcagta caagttcgcc tacgatgtgc aggactcgct gtccggcgat tccaagagcc
      301 aggtggagga gcgcgacgga gatgtggtcc gcggggagta ctcgctgatc gattccgatg
      361 gattcaagcg caccgtccag tacaccgccg atcccatcaa cggattcaat gccgtggtca
      421 accgggaacc tttggttaag accgtggtca agaccgtggc tccagtggcc cccgtctatg
      481 ccgccccagc agccatctac caccactaaa ctctgcctgt ttagattccc tttgttgact
      541 tagttgtagg gttcctttcg caaatatatg ttgtttttt