Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153874 579 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017153874 VERSION XM_017153874.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153874.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..579 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..579 /gene="Cpr5C" /note="Cuticular protein 5C; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:108065739" CDS 57..509 /gene="Cpr5C" /codon_start=1 /product="larval cuticle protein A2B" /protein_id="XP_017009363.2" /db_xref="GeneID:108065739" /translation="MAFKFVALLALIAAASAGVLPAAQVYHAAPVATYAAHAPAAAVL KTVAHPVLAKADEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDSDG FKRTVQYTADPINGFNAVVNREPLVKTVVKTVAPVAPVYAAPAAIYHH" misc_feature 249..407 /gene="Cpr5C" /note="Insect cuticle protein; Region: Chitin_bind_4; pfam00379" /db_xref="CDD:459790" ORIGIN 1 cagcgttcag ttaactaaca tctctcgact ttcagtcttc aaatcaagct cctaaaatgg 61 cattcaagtt tgtggccctc ctcgccctga tcgccgctgc cagtgccggt gtcctgcccg 121 ccgcccaggt gtaccatgcc gctccggtgg ccacctatgc ggctcatgcc cctgccgccg 181 ccgtcctgaa gaccgtggcc catccggtgc tggccaaggc cgacgaggag tacgatcccc 241 atccgcagta caagttcgcc tacgatgtgc aggactcgct gtccggcgat tccaagagcc 301 aggtggagga gcgcgacgga gatgtggtcc gcggggagta ctcgctgatc gattccgatg 361 gattcaagcg caccgtccag tacaccgccg atcccatcaa cggattcaat gccgtggtca 421 accgggaacc tttggttaag accgtggtca agaccgtggc tccagtggcc cccgtctatg 481 ccgccccagc agccatctac caccactaaa ctctgcctgt ttagattccc tttgttgact 541 tagttgtagg gttcctttcg caaatatatg ttgtttttt