Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii fibrinogen-like protein 1


LOCUS       XM_017153873            1247 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065738), mRNA.
ACCESSION   XM_017153873
VERSION     XM_017153873.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153873.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1247
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1247
                     /gene="LOC108065738"
                     /note="fibrinogen-like protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108065738"
     CDS             22..1041
                     /gene="LOC108065738"
                     /codon_start=1
                     /product="fibrinogen-like protein 1"
                     /protein_id="XP_017009362.2"
                     /db_xref="GeneID:108065738"
                     /translation="MKSRALVIVLLLFLLKEHPLAGANSIKDLPQDLLTSSSEPDNHH
                     QNDYFVNLNGEASYMEHTVRDLRSLLAIKTELLIVKDELIKTQREHLNNKNEQISDLR
                     SHIKSLETSISERSNQLSQCRETEANLPDSCPSAISNRIYELKLRGMEPFKAPCRFYA
                     SDMMVIQRRVDGSVNFDRNWSDYKNGFGNVSGEFFLGLEKVHRMTASRPHELHIKLGK
                     VDGSTSYAHYDDFQIGSEDELYELKKLGTFSGEAGDSLKYHLNQKFTTFDRDNDEYEE
                     NCATNGGGGWWYYDCGQSSLNGKYHIDGHNRWSSEDGINWGTWHGYNYTISLTFVEMM
                     IWPKT"
     misc_feature    406..1035
                     /gene="LOC108065738"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    742..744
                     /gene="LOC108065738"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(829..831,835..837,841..843)
                     /gene="LOC108065738"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(853..855,862..867,892..897)
                     /gene="LOC108065738"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     polyA_site      1247
                     /gene="LOC108065738"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgtcgctgc tttcgttcgc aatgaaatcg cgggccttag ttattgttct cttgcttttc
       61 cttctgaaag aacatccttt agctggtgcg aactcaatta aagatttgcc gcaggatcta
      121 cttacatcga gctctgaacc tgataatcat catcaaaatg attattttgt aaatttaaat
      181 ggtgaagcta gttacatgga acatactgta agggacttga gaagtctgtt ggcaataaaa
      241 acagagctac taattgtaaa agacgaacta atcaaaactc agagagaaca ccttaataat
      301 aaaaatgagc aaatctcgga tctacggagt cacattaaat cgcttgagac atcaatatcg
      361 gaaagatcta atcagctttc gcaatgccgt gaaactgagg ccaatttgcc tgactcatgt
      421 cccagtgcca tttccaatag gatttacgaa ctaaaacttc ggggaatgga gccatttaag
      481 gcgccttgta ggttctatgc ttctgatatg atggtaattc agagacgtgt tgacggatca
      541 gtgaacttcg atcgaaactg gagcgattat aaaaacggtt ttggaaatgt cagtggagag
      601 tttttccttg gactggaaaa agtacatcga atgacagcat cacgacccca cgaactccac
      661 attaagcttg ggaaggtcga tgggtccacc agctacgctc attacgatga ttttcaaatt
      721 ggaagcgaag atgaattgta tgagctgaag aagctgggaa cgttttctgg ggaagccgga
      781 gattccctta aatatcacct taaccaaaag tttaccacat ttgatcggga taatgatgag
      841 tatgaagaaa attgcgccac caatggtggc ggtggttggt ggtattatga ttgtggtcaa
      901 agctcgctca atggaaaata ccatatagat ggtcataata gatggtcatc agaagacgga
      961 ataaattggg gcacatggca tggctacaac tatacgatct cgctaacctt cgttgaaatg
     1021 atgatatggc caaaaaccta atgagcctaa atatttatcg aaagacacac agaggaaaat
     1081 accaagaata tgcgttttat tagttaaaat attacaattt tatgttatcg aaattctatt
     1141 tccatttcta gtttcatttc ggttccaaaa aaattaaatt tatagagttg tatgtgcaat
     1201 tccaattgta attattataa ttattaaatc acacttaaaa atcaaaa