Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153873 1247 bp mRNA linear INV 09-DEC-2024 (LOC108065738), mRNA. ACCESSION XM_017153873 VERSION XM_017153873.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153873.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1247 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1247 /gene="LOC108065738" /note="fibrinogen-like protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065738" CDS 22..1041 /gene="LOC108065738" /codon_start=1 /product="fibrinogen-like protein 1" /protein_id="XP_017009362.2" /db_xref="GeneID:108065738" /translation="MKSRALVIVLLLFLLKEHPLAGANSIKDLPQDLLTSSSEPDNHH QNDYFVNLNGEASYMEHTVRDLRSLLAIKTELLIVKDELIKTQREHLNNKNEQISDLR SHIKSLETSISERSNQLSQCRETEANLPDSCPSAISNRIYELKLRGMEPFKAPCRFYA SDMMVIQRRVDGSVNFDRNWSDYKNGFGNVSGEFFLGLEKVHRMTASRPHELHIKLGK VDGSTSYAHYDDFQIGSEDELYELKKLGTFSGEAGDSLKYHLNQKFTTFDRDNDEYEE NCATNGGGGWWYYDCGQSSLNGKYHIDGHNRWSSEDGINWGTWHGYNYTISLTFVEMM IWPKT" misc_feature 406..1035 /gene="LOC108065738" /note="Fibrinogen-related domains (FReDs); C terminal globular domain of fibrinogen. Fibrinogen is involved in blood clotting, being activated by thrombin to assemble into fibrin clots. The N-termini of 2 times 3 chains come together to form a globular...; Region: FReD; cd00087" /db_xref="CDD:238040" misc_feature 742..744 /gene="LOC108065738" /note="gamma-gamma dimer interface [polypeptide binding]; other site" /db_xref="CDD:238040" misc_feature order(829..831,835..837,841..843) /gene="LOC108065738" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238040" misc_feature order(853..855,862..867,892..897) /gene="LOC108065738" /note="polymerization pocket [active]" /db_xref="CDD:238040" polyA_site 1247 /gene="LOC108065738" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgtcgctgc tttcgttcgc aatgaaatcg cgggccttag ttattgttct cttgcttttc 61 cttctgaaag aacatccttt agctggtgcg aactcaatta aagatttgcc gcaggatcta 121 cttacatcga gctctgaacc tgataatcat catcaaaatg attattttgt aaatttaaat 181 ggtgaagcta gttacatgga acatactgta agggacttga gaagtctgtt ggcaataaaa 241 acagagctac taattgtaaa agacgaacta atcaaaactc agagagaaca ccttaataat 301 aaaaatgagc aaatctcgga tctacggagt cacattaaat cgcttgagac atcaatatcg 361 gaaagatcta atcagctttc gcaatgccgt gaaactgagg ccaatttgcc tgactcatgt 421 cccagtgcca tttccaatag gatttacgaa ctaaaacttc ggggaatgga gccatttaag 481 gcgccttgta ggttctatgc ttctgatatg atggtaattc agagacgtgt tgacggatca 541 gtgaacttcg atcgaaactg gagcgattat aaaaacggtt ttggaaatgt cagtggagag 601 tttttccttg gactggaaaa agtacatcga atgacagcat cacgacccca cgaactccac 661 attaagcttg ggaaggtcga tgggtccacc agctacgctc attacgatga ttttcaaatt 721 ggaagcgaag atgaattgta tgagctgaag aagctgggaa cgttttctgg ggaagccgga 781 gattccctta aatatcacct taaccaaaag tttaccacat ttgatcggga taatgatgag 841 tatgaagaaa attgcgccac caatggtggc ggtggttggt ggtattatga ttgtggtcaa 901 agctcgctca atggaaaata ccatatagat ggtcataata gatggtcatc agaagacgga 961 ataaattggg gcacatggca tggctacaac tatacgatct cgctaacctt cgttgaaatg 1021 atgatatggc caaaaaccta atgagcctaa atatttatcg aaagacacac agaggaaaat 1081 accaagaata tgcgttttat tagttaaaat attacaattt tatgttatcg aaattctatt 1141 tccatttcta gtttcatttc ggttccaaaa aaattaaatt tatagagttg tatgtgcaat 1201 tccaattgta attattataa ttattaaatc acacttaaaa atcaaaa