Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii fibrinogen-like protein 1


LOCUS       XM_017153872            1188 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065737), mRNA.
ACCESSION   XM_017153872
VERSION     XM_017153872.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153872.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1188
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1188
                     /gene="LOC108065737"
                     /note="fibrinogen-like protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108065737"
     CDS             17..1063
                     /gene="LOC108065737"
                     /codon_start=1
                     /product="fibrinogen-like protein 1"
                     /protein_id="XP_017009361.2"
                     /db_xref="GeneID:108065737"
                     /translation="MKSVLLVIVIILLIQKECPVFGESSNKELPEEPILQNAKTECND
                     YCFMVFKPILDHFVELKTAANASDELKIEVNTMRDTIKDLQNQLKVTEVQIRGHLENL
                     QHKDDQIADLRNHIKSLETSLSERSNQLSKDREAEANLPDSCPSGSPNGIYELKLRGM
                     ESFRAPCVSSPSGWTVIQRRFDGSENFDRNWSDYKNGFGNVSGEFFLGLEKVHRMTAT
                     RPHELHIKLGKVEGSTSYAHYDDFQIGSEDELYELKKLGRFSGEAGDSLNYHLNKKFT
                     TLDRDNDEHAGNCAKNRGGWWYHLCAKSSLNGKYNGDGHDSSKDGITWGSWHDYNYTI
                     SLTFVEMMIRPKSL"
     misc_feature    <191..>433
                     /gene="LOC108065737"
                     /note="Uncharacterized protein, contains DUF3084 domain
                     [Function unknown]; Region: COG4372"
                     /db_xref="CDD:443500"
     misc_feature    434..1054
                     /gene="LOC108065737"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    770..772
                     /gene="LOC108065737"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(857..859,863..865,869..871)
                     /gene="LOC108065737"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(881..883,890..892,917..922)
                     /gene="LOC108065737"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     polyA_site      1188
                     /gene="LOC108065737"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gctgctatcg ttcgcaatga aatcggtgct tttagtgatt gttataatcc ttttaattca
       61 gaaggaatgt cctgtttttg gtgaaagctc aaacaaagaa ttgccggagg aaccaattct
      121 acagaacgct aaaaccgaat gcaacgatta ttgtttcatg gtctttaagc ccattcttga
      181 tcatttcgta gagctgaaaa cggcagccaa tgcaagcgat gaactgaaaa ttgaagtgaa
      241 tactatgaga gatacaatta aggacctgca aaatcagtta aaagttactg aagttcaaat
      301 caggggtcat cttgaaaacc ttcaacacaa agatgatcaa atcgcggacc tacggaatca
      361 cattaaatcg cttgagacat cactatcgga aagatctaat cagctttcga aagaccgtga
      421 agctgaggct aatttgcctg actcatgtcc cagtggcagt cccaatggga tttacgaact
      481 aaaacttcgg ggaatggagt catttagggc gccttgtgtg tcctctccct ctggttggac
      541 ggtaattcag agacgttttg acggatcaga gaatttcgat cgaaactgga gcgattataa
      601 aaacggtttt ggaaatgtca gtggagagtt tttccttgga ctggaaaaag tacatcgaat
      661 gacagccaca cgaccccacg aactccacat taagcttgga aaggtggagg gatcaaccag
      721 ctacgctcat tacgatgatt ttcaaattgg aagcgaagat gaattgtatg agctgaagaa
      781 actgggaaga ttttctggag aagccggaga ttcccttaac tatcacctta acaaaaagtt
      841 taccacactt gatcgggata atgatgagca tgcaggaaat tgcgccaaga accgtggtgg
      901 ttggtggtat catctttgtg caaaaagttc gcttaatgga aaatacaatg gagatggtca
      961 tgatagttca aaagacggaa tcacttgggg ctcatggcat gactacaact atacgatatc
     1021 gctaaccttc gttgaaatga tgataaggcc taaatcctta tgagccacaa attctgcaat
     1081 tacaaacata cagaatgaat cgaaattaat tgctaggaat aaaatgataa aatgaattca
     1141 ataacatgtc aaattcaata aatacttatt actaaaagtt tttagaaa