Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ubiquitin specific protease 30


LOCUS       XM_017153858            2310 bp    mRNA    linear   INV 09-DEC-2024
            (Usp30), mRNA.
ACCESSION   XM_017153858
VERSION     XM_017153858.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153858.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2310
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2310
                     /gene="Usp30"
                     /note="ubiquitin specific protease 30; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108065724"
     CDS             203..1849
                     /gene="Usp30"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase 30
                     homolog"
                     /protein_id="XP_017009347.1"
                     /db_xref="GeneID:108065724"
                     /translation="MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNF
                     GRTCFLNTLLQAMAACPQFIAWLQLYNNASPDRKSLITSMLNTLEVVNGTHATLRGDP
                     HSPGAVLRALNSLGWVIPQEEHDAHELFHVLLSSLEEEAIRPHPLGCLSDALPADSAD
                     DAISFAGTATPVGGFRPISSMAAPRIGDQPNRPSSAMLTDFLNMEYDESTSLQRLVRS
                     EAHTPDSPASVCEREGNDRLGSLLLDAVSPGTPFGFPLASELESSLGGERLSRPRQQQ
                     QAEEQGLNRRVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGS
                     KSAVRYDKFDSITLNLPPQRRTGLSLGHLLSDYITSEDLSDVKCDSCNETTTHTKSVT
                     FAKLPACLCIHVARTVWLPTGQVCKRQDYVHFPESLSMAPYSFVQPHLNSQAGTPWGS
                     TMSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNA
                     HRWFYTSDTIVREVSIDEVLSVPAYLLFYDRGQQRQLNLR"
     misc_feature    317..>619
                     /gene="Usp30"
                     /note="Peptidase C19 contains ubiquitinyl hydrolases. They
                     are intracellular peptidases that remove ubiquitin
                     molecules from polyubiquinated peptides by cleavage of
                     isopeptide bonds. They hydrolyse bonds involving the
                     carboxyl group of the C-terminal Gly...; Region:
                     Peptidase_C19; cl02553"
                     /db_xref="CDD:470612"
     misc_feature    1007..1816
                     /gene="Usp30"
                     /note="A subfamily of Peptidase C19. Peptidase C19
                     contains ubiquitinyl hydrolases. They are intracellular
                     peptidases that remove ubiquitin molecules from
                     polyubiquinated peptides by cleavage of isopeptide bonds.
                     They hydrolyze bonds involving the carboxyl...; Region:
                     Peptidase_C19F; cd02662"
                     /db_xref="CDD:239127"
     polyA_site      2310
                     /gene="Usp30"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atacagtccc acagggtgat tcaggtattt gatggtattt tctgtcccat ccctagcaca
       61 gggtgttcac agagctacgg ctgttaaaaa aacatttttt ttcggtccag tcaaaatttg
      121 ccattaaaat ttgcgccgat tgcagcggga tcaggagctc ccttacattg ggcctccctt
      181 tgggcaaccc ggaacgaaac ccatggagag cgagaagatt ctgatggccg ccggagtgac
      241 ggtggccgcc gtggtgggag cctttgtatt ttggggtcct tcaggctcta gactccgcca
      301 gcgacgcggc caaatcgccg ggctgcacaa cttcggacgc acctgtttcc tgaacacgct
      361 gctccaggcg atggccgcct gtccgcagtt catcgcctgg ctgcagctgt acaataatgc
      421 ctctcccgat cgcaagagcc tcatcacctc gatgctaaac actctggagg tggtcaacgg
      481 cacccatgcc acgctgcgcg gcgatccgca ttccccgggc gccgttctgc gtgccctgaa
      541 ttccctgggt tgggtcattc cccaggagga gcacgatgcc cacgagctgt tccacgttct
      601 gttgtcctcg ctggaggagg aggccatacg gccgcatccc ctgggctgcc tgtcggatgc
      661 tttgccagcg gatagtgcag acgatgcgat cagctttgcg ggcacagcca ctccggtcgg
      721 tggcttccga ccgattagct ccatggcggc gccgcggatt ggggatcagc cgaacagacc
      781 ctcgagcgcc atgctcaccg atttcctgaa catggagtac gatgagagta ccagtttgca
      841 gcgcctggtg cgttccgagg cccacacacc ggattcgccc gcctccgttt gcgaacgcga
      901 gggcaacgat cgtctgggct ccctgctgct ggacgccgtt tcgccgggca cgccgttcgg
      961 ctttccactg gccagcgaac tggagtcttc gctgggcggc gagcggctgt cgcgtccgcg
     1021 gcagcagcag caggcggagg agcagggcct caatcgccgg gtctccagct cgtgtcgctc
     1081 gctggagcga ctgcatcgcg gacccggccg cgtgtccatc tggtccaaca tgatgcccag
     1141 ccaggtggcg catccgtttc agggcgccat gggcgcccag atcgtctgta atggctgcgg
     1201 ctccaagtcg gcggtgcgtt atgataagtt cgatagcatc accctcaatt tgccgccgca
     1261 gcggaggact ggtttgagtt tgggccacct gctgagcgac tacatcacgt cggaggatct
     1321 gagcgacgtc aagtgcgact cctgcaacga gacgaccacg cacaccaagt cggttacgtt
     1381 tgccaagctg cccgcctgcc tgtgcatcca tgtggcgcgg accgtgtggc tgcccacggg
     1441 gcaggtgtgc aagcgacagg actacgtcca cttccccgag agcctctcca tggcgcccta
     1501 cagcttcgtt cagccgcacc tcaacagcca ggctggcact ccctggggct cgacgatgtc
     1561 gctgtactcc tccagcctgc cgatgaacaa tggcgtgggt ggcggcgagg gcttcggcac
     1621 gatgttcccc aagaatctgt accgcctgct ggccgtggtg gtgcactcgg gcgaggcgaa
     1681 cagcggtcac tttgtgacct acaggcgggg ctccttgcgg aatgcacatc ggtggttcta
     1741 cacatccgat acgattgtgc gggaggtgag catcgatgag gtgctgagcg ttcccgccta
     1801 tttgcttttc tacgatcgcg gccagcaaag acagctcaac ctacgctagt cggctagtca
     1861 gccaaagagc tctcgcatct tgggatcatc gggatcgtca tcctagtcaa cacttgatgt
     1921 gatggaaatc caaatccaaa aatccttatt gtcgaacggt ggccatagcg aacacgcgtc
     1981 acatttatat atagatatat atatatataa cttattatat atgtacggga acccacgatc
     2041 tgatctatac tcgacggggt tatgtaatgg tctctgcata atgcataatg catattttca
     2101 gcatattgcc atttgaaatc tgcatcaccc tcacgtcgca gagaactcga ctcttcattt
     2161 gttatcgatg catttaagat tttttaagaa ttccaaattc atactgtgct tttagctgtc
     2221 tgtatttagc aatatacaca cataaactac cagtaattgt ttgcgcgtta tttctgtagg
     2281 ttagatgttc aataaaaatt tggaaactac