Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153858 2310 bp mRNA linear INV 09-DEC-2024 (Usp30), mRNA. ACCESSION XM_017153858 VERSION XM_017153858.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153858.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2310 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..2310 /gene="Usp30" /note="ubiquitin specific protease 30; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065724" CDS 203..1849 /gene="Usp30" /codon_start=1 /product="ubiquitin carboxyl-terminal hydrolase 30 homolog" /protein_id="XP_017009347.1" /db_xref="GeneID:108065724" /translation="MESEKILMAAGVTVAAVVGAFVFWGPSGSRLRQRRGQIAGLHNF GRTCFLNTLLQAMAACPQFIAWLQLYNNASPDRKSLITSMLNTLEVVNGTHATLRGDP HSPGAVLRALNSLGWVIPQEEHDAHELFHVLLSSLEEEAIRPHPLGCLSDALPADSAD DAISFAGTATPVGGFRPISSMAAPRIGDQPNRPSSAMLTDFLNMEYDESTSLQRLVRS EAHTPDSPASVCEREGNDRLGSLLLDAVSPGTPFGFPLASELESSLGGERLSRPRQQQ QAEEQGLNRRVSSSCRSLERLHRGPGRVSIWSNMMPSQVAHPFQGAMGAQIVCNGCGS KSAVRYDKFDSITLNLPPQRRTGLSLGHLLSDYITSEDLSDVKCDSCNETTTHTKSVT FAKLPACLCIHVARTVWLPTGQVCKRQDYVHFPESLSMAPYSFVQPHLNSQAGTPWGS TMSLYSSSLPMNNGVGGGEGFGTMFPKNLYRLLAVVVHSGEANSGHFVTYRRGSLRNA HRWFYTSDTIVREVSIDEVLSVPAYLLFYDRGQQRQLNLR" misc_feature 317..>619 /gene="Usp30" /note="Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly...; Region: Peptidase_C19; cl02553" /db_xref="CDD:470612" misc_feature 1007..1816 /gene="Usp30" /note="A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl...; Region: Peptidase_C19F; cd02662" /db_xref="CDD:239127" polyA_site 2310 /gene="Usp30" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atacagtccc acagggtgat tcaggtattt gatggtattt tctgtcccat ccctagcaca 61 gggtgttcac agagctacgg ctgttaaaaa aacatttttt ttcggtccag tcaaaatttg 121 ccattaaaat ttgcgccgat tgcagcggga tcaggagctc ccttacattg ggcctccctt 181 tgggcaaccc ggaacgaaac ccatggagag cgagaagatt ctgatggccg ccggagtgac 241 ggtggccgcc gtggtgggag cctttgtatt ttggggtcct tcaggctcta gactccgcca 301 gcgacgcggc caaatcgccg ggctgcacaa cttcggacgc acctgtttcc tgaacacgct 361 gctccaggcg atggccgcct gtccgcagtt catcgcctgg ctgcagctgt acaataatgc 421 ctctcccgat cgcaagagcc tcatcacctc gatgctaaac actctggagg tggtcaacgg 481 cacccatgcc acgctgcgcg gcgatccgca ttccccgggc gccgttctgc gtgccctgaa 541 ttccctgggt tgggtcattc cccaggagga gcacgatgcc cacgagctgt tccacgttct 601 gttgtcctcg ctggaggagg aggccatacg gccgcatccc ctgggctgcc tgtcggatgc 661 tttgccagcg gatagtgcag acgatgcgat cagctttgcg ggcacagcca ctccggtcgg 721 tggcttccga ccgattagct ccatggcggc gccgcggatt ggggatcagc cgaacagacc 781 ctcgagcgcc atgctcaccg atttcctgaa catggagtac gatgagagta ccagtttgca 841 gcgcctggtg cgttccgagg cccacacacc ggattcgccc gcctccgttt gcgaacgcga 901 gggcaacgat cgtctgggct ccctgctgct ggacgccgtt tcgccgggca cgccgttcgg 961 ctttccactg gccagcgaac tggagtcttc gctgggcggc gagcggctgt cgcgtccgcg 1021 gcagcagcag caggcggagg agcagggcct caatcgccgg gtctccagct cgtgtcgctc 1081 gctggagcga ctgcatcgcg gacccggccg cgtgtccatc tggtccaaca tgatgcccag 1141 ccaggtggcg catccgtttc agggcgccat gggcgcccag atcgtctgta atggctgcgg 1201 ctccaagtcg gcggtgcgtt atgataagtt cgatagcatc accctcaatt tgccgccgca 1261 gcggaggact ggtttgagtt tgggccacct gctgagcgac tacatcacgt cggaggatct 1321 gagcgacgtc aagtgcgact cctgcaacga gacgaccacg cacaccaagt cggttacgtt 1381 tgccaagctg cccgcctgcc tgtgcatcca tgtggcgcgg accgtgtggc tgcccacggg 1441 gcaggtgtgc aagcgacagg actacgtcca cttccccgag agcctctcca tggcgcccta 1501 cagcttcgtt cagccgcacc tcaacagcca ggctggcact ccctggggct cgacgatgtc 1561 gctgtactcc tccagcctgc cgatgaacaa tggcgtgggt ggcggcgagg gcttcggcac 1621 gatgttcccc aagaatctgt accgcctgct ggccgtggtg gtgcactcgg gcgaggcgaa 1681 cagcggtcac tttgtgacct acaggcgggg ctccttgcgg aatgcacatc ggtggttcta 1741 cacatccgat acgattgtgc gggaggtgag catcgatgag gtgctgagcg ttcccgccta 1801 tttgcttttc tacgatcgcg gccagcaaag acagctcaac ctacgctagt cggctagtca 1861 gccaaagagc tctcgcatct tgggatcatc gggatcgtca tcctagtcaa cacttgatgt 1921 gatggaaatc caaatccaaa aatccttatt gtcgaacggt ggccatagcg aacacgcgtc 1981 acatttatat atagatatat atatatataa cttattatat atgtacggga acccacgatc 2041 tgatctatac tcgacggggt tatgtaatgg tctctgcata atgcataatg catattttca 2101 gcatattgcc atttgaaatc tgcatcaccc tcacgtcgca gagaactcga ctcttcattt 2161 gttatcgatg catttaagat tttttaagaa ttccaaattc atactgtgct tttagctgtc 2221 tgtatttagc aatatacaca cataaactac cagtaattgt ttgcgcgtta tttctgtagg 2281 ttagatgttc aataaaaatt tggaaactac