Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153845 710 bp mRNA linear INV 09-DEC-2024 protein MPV17 (Mpv17), mRNA. ACCESSION XM_017153845 VERSION XM_017153845.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153845.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..710 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..710 /gene="Mpv17" /note="Mitochondrial inner membrane protein MPV17; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108065719" CDS 126..632 /gene="Mpv17" /codon_start=1 /product="mitochondrial inner membrane protein Mpv17" /protein_id="XP_017009334.2" /db_xref="GeneID:108065719" /translation="MSGLKVFLKEGFNVAAVMGLGDVIAQFGVEKKSLDEWDAGRTLR FGALGMVFVGPVLRRFYGFLESRVPKTYTPIRRGAIKMLVDQGLFVPPFALAMSFLVP LVNGEPMDKIRQRIIDTYPTILVRNYMLWPAAQMINFSFVPLGYQVIYVQCVALVWNC YLSIVLNK" misc_feature 432..614 /gene="Mpv17" /note="Mpv17 / PMP22 family; Region: Mpv17_PMP22; pfam04117" /db_xref="CDD:461182" ORIGIN 1 ttgcctccaa caacgtaccc cctttgaatt caatagacaa ccctttttaa atcgcatacg 61 caatgcaatc ggttattcag agtggtgttt gaaattgccg gtttcgagtc gaaggccagt 121 tgaagatgtc gggactcaag gtgttcctga aggagggctt taatgtggcg gcggtgatgg 181 gtctgggcga tgtgatagcc cagtttggcg tcgagaagaa gtcgctggac gagtgggatg 241 ccggccgaac gcttcgtttt ggcgccctgg ggatggtgtt tgtgggtccg gtgctccggc 301 gattttacgg cttcctggag tcgcgggttc ccaagaccta caccccgatc cgcaggggag 361 ccatcaagat gctggtcgac caaggcctct tcgtgccccc ctttgcgctg gccatgtcct 421 tcctggtgcc gctggtcaat ggcgagccga tggacaaaat ccgtcagcgc atcatcgaca 481 cctaccccac catcctggtc cgcaactaca tgctctggcc agccgcccag atgatcaact 541 tcagcttcgt gccgctgggc taccaggtga tctacgtgca gtgtgtcgcc ctcgtctgga 601 actgctacct ctccatagtc ctcaacaaat agggctacgg actactccta tctttatccg 661 tatccgcatc cgcatctgaa tccatgtgcg gattcaccag gtcgaataaa