Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Mitochondrial inner membrane


LOCUS       XM_017153845             710 bp    mRNA    linear   INV 09-DEC-2024
            protein MPV17 (Mpv17), mRNA.
ACCESSION   XM_017153845
VERSION     XM_017153845.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153845.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..710
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..710
                     /gene="Mpv17"
                     /note="Mitochondrial inner membrane protein MPV17; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108065719"
     CDS             126..632
                     /gene="Mpv17"
                     /codon_start=1
                     /product="mitochondrial inner membrane protein Mpv17"
                     /protein_id="XP_017009334.2"
                     /db_xref="GeneID:108065719"
                     /translation="MSGLKVFLKEGFNVAAVMGLGDVIAQFGVEKKSLDEWDAGRTLR
                     FGALGMVFVGPVLRRFYGFLESRVPKTYTPIRRGAIKMLVDQGLFVPPFALAMSFLVP
                     LVNGEPMDKIRQRIIDTYPTILVRNYMLWPAAQMINFSFVPLGYQVIYVQCVALVWNC
                     YLSIVLNK"
     misc_feature    432..614
                     /gene="Mpv17"
                     /note="Mpv17 / PMP22 family; Region: Mpv17_PMP22;
                     pfam04117"
                     /db_xref="CDD:461182"
ORIGIN      
        1 ttgcctccaa caacgtaccc cctttgaatt caatagacaa ccctttttaa atcgcatacg
       61 caatgcaatc ggttattcag agtggtgttt gaaattgccg gtttcgagtc gaaggccagt
      121 tgaagatgtc gggactcaag gtgttcctga aggagggctt taatgtggcg gcggtgatgg
      181 gtctgggcga tgtgatagcc cagtttggcg tcgagaagaa gtcgctggac gagtgggatg
      241 ccggccgaac gcttcgtttt ggcgccctgg ggatggtgtt tgtgggtccg gtgctccggc
      301 gattttacgg cttcctggag tcgcgggttc ccaagaccta caccccgatc cgcaggggag
      361 ccatcaagat gctggtcgac caaggcctct tcgtgccccc ctttgcgctg gccatgtcct
      421 tcctggtgcc gctggtcaat ggcgagccga tggacaaaat ccgtcagcgc atcatcgaca
      481 cctaccccac catcctggtc cgcaactaca tgctctggcc agccgcccag atgatcaact
      541 tcagcttcgt gccgctgggc taccaggtga tctacgtgca gtgtgtcgcc ctcgtctgga
      601 actgctacct ctccatagtc ctcaacaaat agggctacgg actactccta tctttatccg
      661 tatccgcatc cgcatctgaa tccatgtgcg gattcaccag gtcgaataaa