Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutamate receptor interacting


LOCUS       XM_017153812            3834 bp    mRNA    linear   INV 09-DEC-2024
            protein (Grip), transcript variant X2, mRNA.
ACCESSION   XM_017153812
VERSION     XM_017153812.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153812.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3834
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..3834
                     /gene="Grip"
                     /note="Glutamate receptor interacting protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108065695"
     CDS             274..3480
                     /gene="Grip"
                     /codon_start=1
                     /product="glutamate receptor-interacting protein 1 isoform
                     X2"
                     /protein_id="XP_017009301.2"
                     /db_xref="GeneID:108065695"
                     /translation="MKLWKSKKPIVGCVPGKSAALKQDQQQQQQQQQQQESHNSSFNG
                     HHHPPTDTALAPMLSVDRAMSPAQSEDSGLAPERGTTYATITLPRNALHLAITFAERN
                     DLSYPPVVGSLSPVGHAADFLAPGDRLHQIDGISTIGLSNQKVMNMLCAGGSDAGPAI
                     VEIEYSLPEYISQNSLCVTSKLAQITVERESGCLGLTLRGGADYPLIVTHVRPHGPVY
                     KTGRIKPGDRLLRVDNVSLIGKTLAEAQQIIKCGGHVSGYTNLTIEYDVSVVQSVEFS
                     MGPLIIEIERPMNDKLGLVLCNYTPAMAASGSGSSTPSSGEKIEESTGVFIASILPAS
                     IADRCGALSVGDQVLSIDDTMIEHTAFSPDEVMTILDTSTGRGYTQMQIMPAHALARR
                     GHTALGSPKYSFSTLESRKSSTAGRQRQRFARKSSLPLENAGVNTPGSSVGMVGLGLC
                     RAESFPVLLDCSHGAGIILGESPAGGGAGGGSAGGGAVAIAQILNDSVADRSGCIQAG
                     DRIVAINKMYSLDAGAMRQLLEGGSGRGGAGNNSGTPPANWLELEIEFDMPDAVVPAS
                     GVFSVKLLRAGKCGLGLSVSGSSHGGLVISDVKMGSPAHRSGSLRSGDILLAVDQHPV
                     QHFNVDALLKEQQNPSSSASSASSDFTTLTIKRIVLPDFLPMSSPIYSNCPPMAMGMG
                     GMGVSSSSTDHDLYSSAYVTAGKYADCVSLKSRTPQPDYFRVPSMDDASLQSVQLRSG
                     SGCSGNGGSRGVNEAGNGWSTAGVNSRSFGAASNQLPNTQSLTTELPEEEDEQEQLYP
                     GYELNRYASVDCTALPPPMENKVYGSAASSSSKSSGSSLHQIIFTVRLEPKGGLLGIT
                     LAGSEDITKPITISGLVEGGIAHKNGQIHVSDQLLAIDEHSVQGMPLSHATSLLQNLG
                     DLVDLKILRSHDLANGSHLPQTQAIYAKVQRRPRSPSANTEASKESGNGNSNGCGAGS
                     NGNGGNGKPRVFHVTLYKDKVYDDYGFSVSDGLYERGVFINRIRSGGPADMCGLLKPF
                     DRIMQVNEMKTQDFDCCLTVPLIAAAGDKIEMIMQRTE"
     misc_feature    520..768
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    order(550..564,604..606,613..615,697..699,709..711,
                     718..723)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467153"
     misc_feature    814..1071
                     /gene="Grip"
                     /note="PDZ domain 2 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ2_GRIP1-2-like; cd06681"
                     /db_xref="CDD:467169"
     misc_feature    order(850..870,898..900,907..909,997..999,1009..1011,
                     1018..1023)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467169"
     misc_feature    1105..1428
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    order(1144..1164,1255..1257,1264..1266,1360..1362,
                     1372..1374,1381..1386)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467153"
     misc_feature    <1747..2244
                     /gene="Grip"
                     /note="periplasmic serine protease, Do/DeqQ family;
                     Region: degP_htrA_DO; TIGR02037"
                     /db_xref="CDD:273938"
     misc_feature    1978..>2133
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    2788..3042
                     /gene="Grip"
                     /note="PDZ domain 6 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ6_GRIP1-2-like; cd06683"
                     /db_xref="CDD:467171"
     misc_feature    order(2827..2847,2881..2883,2890..2892,2980..2982,
                     2992..2994,3001..3006)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467171"
     misc_feature    3214..3471
                     /gene="Grip"
                     /note="PDZ domain 7 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ7_GRIP1-2-like; cd06685"
                     /db_xref="CDD:467173"
     misc_feature    order(3259..3279,3310..3312,3319..3321,3409..3411,
                     3421..3423,3430..3435)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467173"
     misc_feature    order(3379..3381,3388..3390,3403..3405,3412..3417,
                     3424..3429)
                     /gene="Grip"
                     /note="GRASP-1 binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467173"
ORIGIN      
        1 tgttccgcgg acgtgcgcgc atcgttcagg ttcagtcgca tcgcagtcgc cgtcgcaggc
       61 gttgaatttc ggaatttccc aatttccatt ggaaagcgaa ttgattttga aatcccccct
      121 cgatttcgaa ctgtgcaatt attatttttt ttatttttaa tccttttttt ttttactgtg
      181 aaaatgccaa atctgccatg agttgtggaa aatcgtaaag atcgcgtttt cccacttttt
      241 ttggatggga agtggcagaa aagaaaactc aaaatgaaac tgtggaaatc aaagaagccc
      301 attgtgggct gtgtgcctgg aaaatcggcg gccctcaaac aggaccaaca gcagcaacaa
      361 caacaacagc agcaacagga gtcgcacaac agctccttca atggacatca tcatccgccg
      421 acggacaccg ccttggcgcc catgttatcc gtggaccggg cgatgagtcc ggcgcaatcg
      481 gaggactccg gattggcacc ggaaagggga accacctacg ccaccatcac tctgccacgg
      541 aatgccctgc atttggccat cacattcgca gaacgcaacg atctttctta tccgccggtg
      601 gttggatctc tgagtcccgt gggccatgcg gcggatttct tggcgcccgg cgatcgcctt
      661 catcagatcg atggaatctc gacgattggc ttgagcaacc agaaggtgat gaacatgctc
      721 tgcgctggag gatcggatgc gggtcctgcc atcgtggaga tcgagtactc gctgcccgaa
      781 tacatttccc agaacagcct ctgtgtgacc tcgaagctgg cgcagatcac cgtggagcgg
      841 gaaagtggat gcctgggcct gacgctgagg ggcggggccg actatccgct gatcgtcacc
      901 catgtgaggc cccatggacc cgtctataag accggtcgca tcaagcccgg cgatcgcttg
      961 ttgcgcgtcg ataatgtctc acttattggc aaaacgctgg cagaggcgca acagatcatc
     1021 aagtgcggcg gtcatgtttc cgggtatacc aacctgacca tcgagtacga tgtttccgtg
     1081 gtgcagagcg ttgagttctc gatgggaccg ctgatcatcg agatcgagcg gccgatgaac
     1141 gataagttgg gcctggtact ttgcaactat acgccggcga tggccgcttc cggttccggt
     1201 tcgagtacgc catccagtgg ggagaagatc gaggaatcga cgggcgtctt tatagccagc
     1261 atcctgcccg ctagcattgc agatcgttgc ggcgccttat ccgtcggcga tcaggtgctc
     1321 tccatcgacg acacaatgat cgagcacacc gccttcagtc ccgacgaggt gatgaccata
     1381 ttggacacca gcacgggtcg cggctacacg cagatgcaga tcatgcccgc tcacgcgttg
     1441 gcccgtcgcg gacacacggc attgggcagt cccaagtaca gctttagcac cctggagtcc
     1501 cgcaaatcct cgacggcggg tcgccagcgt cagcgtttcg cccgcaagag ttccctgccg
     1561 ctggagaatg caggggtcaa cactccggga tcctcggtgg gcatggtggg tctgggcctc
     1621 tgccgcgccg agagctttcc cgttctcctc gactgcagcc acggagcggg cattatcctg
     1681 ggggaatctc cagcaggagg aggagcagga ggaggatctg ccggcggagg agctgtggcc
     1741 attgcccaga tcctcaacga ttcggtggcc gatcgcagtg gctgcattca ggcgggcgat
     1801 cgcattgtgg ccatcaacaa gatgtacagc ctggatgcgg gggccatgag gcagctgctc
     1861 gagggaggat cgggtcgcgg aggagcagga aacaactcgg gaacgccgcc ggccaattgg
     1921 ctggagctgg agatcgagtt cgatatgccg gatgccgtgg tgcctgccag tggtgtcttt
     1981 agtgtcaagc tgctgagggc cggcaaatgt ggattgggac tgagtgtgag tggctccagc
     2041 catggcggcc tggtcatttc ggacgtcaag atgggcagtc cggcgcatcg cagcggctct
     2101 ttgagatcgg gcgacatcct gctggccgtc gaccagcatc cagtgcagca tttcaatgtg
     2161 gacgcactgc tcaaggagca gcagaatccc tcatcctccg cgtcctccgc ctcctcggat
     2221 ttcaccacgc tcaccatcaa gcggatcgtc ctgcccgact tcctgcccat gtccagtccc
     2281 atctacagca attgcccacc gatggccatg ggaatgggcg gcatgggtgt ctcgtccagc
     2341 agcacggatc acgatctgta tagcagcgcc tatgtgacgg cgggcaagta cgccgactgc
     2401 gtctccctga agtcgcggac tccgcagccg gactacttcc gggtgcccag catggacgac
     2461 gccagtctgc agtcggtgca gctgcgttcc ggatcggggt gctcggggaa tggcggcagt
     2521 cgaggggtca acgaggcagg caacggctgg tccaccgccg gcgtcaacag ccgatccttt
     2581 ggggcagcca gcaaccaact gcccaacacc cagagcctga ccaccgagct gcccgaggag
     2641 gaggacgaac aggagcagct gtatcccggc tacgagctca atcgctatgc cagtgtggac
     2701 tgcaccgccc tgccgccgcc catggagaac aaggtctacg gatcggcggc cagttcgagc
     2761 agcaagagca gcgggagcag cctgcaccag atcatcttca cggtgcgtct ggagcccaag
     2821 gggggactgc tgggcatcac tctggctggc agcgaggata tcaccaagcc catcacgatc
     2881 agtggtctcg tggagggtgg cattgcgcac aagaatggcc agatccatgt gagtgaccag
     2941 ctgctggcca tcgacgagca ctcggtgcag ggcatgcccc tttcgcatgc caccagtctg
     3001 ctgcagaatc tcggcgatct ggtggacctg aagatcctgc ggagtcacga tctggccaac
     3061 ggcagtcatc tgccgcagac gcaggccatt tacgcgaagg tccagcggcg tccgcggagt
     3121 ccttcggcga atacggaggc cagcaaggag tcggggaatg gaaatagcaa cggatgtgga
     3181 gctggcagta atggcaatgg cggaaatgga aagccccgcg tcttccatgt caccctgtac
     3241 aaggacaagg tgtacgacga ctatggcttc tcggtttccg atggactcta cgagcggggc
     3301 gtcttcatca acaggattcg cagtggcggg ccggcggata tgtgcggtct cctgaagccc
     3361 ttcgatcgca ttatgcaggt taacgaaatg aagacgcagg actttgattg ctgccttact
     3421 gttccgctga tcgccgccgc cggcgataaa atcgagatga tcatgcagcg cacagagtga
     3481 tcctcagtgt gcgcgatcct tatgttaaac tagttgtacg ctaagctaat cctaagtgcc
     3541 attgctagcc cataatatta tatacgatat cccctccgta ttctgtattc tgtatgctgt
     3601 actccttacc gaacgaaacg taatccacga aacagaaaga taaacaccaa ccttcaagga
     3661 caataagctc tctaaacaac agtctgccat aaccaaaaaa tgtcctctat ttaatataaa
     3721 tctgccataa ttttacatta attctacgct aaatttgttt cctagcaaat aaataatcat
     3781 accgacagtt tgtttcaaac taaacaatca agaactatga gtaatttcat tgct