Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutamate receptor interacting


LOCUS       XM_017153811            3836 bp    mRNA    linear   INV 09-DEC-2024
            protein (Grip), transcript variant X1, mRNA.
ACCESSION   XM_017153811
VERSION     XM_017153811.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153811.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3836
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..3836
                     /gene="Grip"
                     /note="Glutamate receptor interacting protein; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108065695"
     CDS             274..3483
                     /gene="Grip"
                     /codon_start=1
                     /product="glutamate receptor-interacting protein 1 isoform
                     X1"
                     /protein_id="XP_017009300.2"
                     /db_xref="GeneID:108065695"
                     /translation="MKLWKSKKPIVGCVPGKSAALKQDQQQQQQQQQQQESHNSSFNG
                     HHHPPTDTALAPMLSVDRAMSPAQSEDSGLAPERGTTYATITLPRNALHLAITFAERN
                     DLSYPPVVGSLSPVGHAADFLAPGDRLHQIDGISTIGLSNQKVMNMLCAGGSDAGPAI
                     VEIEYSLPEYTVSQNSLCVTSKLAQITVERESGCLGLTLRGGADYPLIVTHVRPHGPV
                     YKTGRIKPGDRLLRVDNVSLIGKTLAEAQQIIKCGGHVSGYTNLTIEYDVSVVQSVEF
                     SMGPLIIEIERPMNDKLGLVLCNYTPAMAASGSGSSTPSSGEKIEESTGVFIASILPA
                     SIADRCGALSVGDQVLSIDDTMIEHTAFSPDEVMTILDTSTGRGYTQMQIMPAHALAR
                     RGHTALGSPKYSFSTLESRKSSTAGRQRQRFARKSSLPLENAGVNTPGSSVGMVGLGL
                     CRAESFPVLLDCSHGAGIILGESPAGGGAGGGSAGGGAVAIAQILNDSVADRSGCIQA
                     GDRIVAINKMYSLDAGAMRQLLEGGSGRGGAGNNSGTPPANWLELEIEFDMPDAVVPA
                     SGVFSVKLLRAGKCGLGLSVSGSSHGGLVISDVKMGSPAHRSGSLRSGDILLAVDQHP
                     VQHFNVDALLKEQQNPSSSASSASSDFTTLTIKRIVLPDFLPMSSPIYSNCPPMAMGM
                     GGMGVSSSSTDHDLYSSAYVTAGKYADCVSLKSRTPQPDYFRVPSMDDASLQSVQLRS
                     GSGCSGNGGSRGVNEAGNGWSTAGVNSRSFGAASNQLPNTQSLTTELPEEEDEQEQLY
                     PGYELNRYASVDCTALPPPMENKVYGSAASSSSKSSGSSLHQIIFTVRLEPKGGLLGI
                     TLAGSEDITKPITISGLVEGGIAHKNGQIHVSDQLLAIDEHSVQGMPLSHATSLLQNL
                     GDLVDLKILRSHDLANGSHLPQTQAIYAKVQRRPRSPSANTEASKESGNGNSNGCGAG
                     SNGNGGNGKPRVFHVTLYKDKVYDDYGFSVSDGLYERGVFINRIRSGGPADMCGLLKP
                     FDRIMQVNEMKTQDFDCCLTVPLIAAAGDKIEMIMQRTE"
     misc_feature    520..768
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    order(550..564,604..606,613..615,697..699,709..711,
                     718..723)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467153"
     misc_feature    817..1074
                     /gene="Grip"
                     /note="PDZ domain 2 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ2_GRIP1-2-like; cd06681"
                     /db_xref="CDD:467169"
     misc_feature    order(853..873,901..903,910..912,1000..1002,1012..1014,
                     1021..1026)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467169"
     misc_feature    1108..1431
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    order(1147..1167,1258..1260,1267..1269,1363..1365,
                     1375..1377,1384..1389)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467153"
     misc_feature    <1750..2247
                     /gene="Grip"
                     /note="periplasmic serine protease, Do/DeqQ family;
                     Region: degP_htrA_DO; TIGR02037"
                     /db_xref="CDD:273938"
     misc_feature    1981..>2136
                     /gene="Grip"
                     /note="canonical PDZ domain; Region: PDZ_canonical;
                     cl49608"
                     /db_xref="CDD:483948"
     misc_feature    2791..3045
                     /gene="Grip"
                     /note="PDZ domain 6 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ6_GRIP1-2-like; cd06683"
                     /db_xref="CDD:467171"
     misc_feature    order(2830..2850,2884..2886,2893..2895,2983..2985,
                     2995..2997,3004..3009)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467171"
     misc_feature    3217..3474
                     /gene="Grip"
                     /note="PDZ domain 7 of glutamate receptor-interacting
                     protein 1 (GRIP1) and GRIP2, and related domains; Region:
                     PDZ7_GRIP1-2-like; cd06685"
                     /db_xref="CDD:467173"
     misc_feature    order(3262..3282,3313..3315,3322..3324,3412..3414,
                     3424..3426,3433..3438)
                     /gene="Grip"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467173"
     misc_feature    order(3382..3384,3391..3393,3406..3408,3415..3420,
                     3427..3432)
                     /gene="Grip"
                     /note="GRASP-1 binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467173"
ORIGIN      
        1 tgttccgcgg acgtgcgcgc atcgttcagg ttcagtcgca tcgcagtcgc cgtcgcaggc
       61 gttgaatttc ggaatttccc aatttccatt ggaaagcgaa ttgattttga aatcccccct
      121 cgatttcgaa ctgtgcaatt attatttttt ttatttttaa tccttttttt ttttactgtg
      181 aaaatgccaa atctgccatg agttgtggaa aatcgtaaag atcgcgtttt cccacttttt
      241 ttggatggga agtggcagaa aagaaaactc aaaatgaaac tgtggaaatc aaagaagccc
      301 attgtgggct gtgtgcctgg aaaatcggcg gccctcaaac aggaccaaca gcagcaacaa
      361 caacaacagc agcaacagga gtcgcacaac agctccttca atggacatca tcatccgccg
      421 acggacaccg ccttggcgcc catgttatcc gtggaccggg cgatgagtcc ggcgcaatcg
      481 gaggactccg gattggcacc ggaaagggga accacctacg ccaccatcac tctgccacgg
      541 aatgccctgc atttggccat cacattcgca gaacgcaacg atctttctta tccgccggtg
      601 gttggatctc tgagtcccgt gggccatgcg gcggatttct tggcgcccgg cgatcgcctt
      661 catcagatcg atggaatctc gacgattggc ttgagcaacc agaaggtgat gaacatgctc
      721 tgcgctggag gatcggatgc gggtcctgcc atcgtggaga tcgagtactc gctgcccgaa
      781 tacacagttt cccagaacag cctctgtgtg acctcgaagc tggcgcagat caccgtggag
      841 cgggaaagtg gatgcctggg cctgacgctg aggggcgggg ccgactatcc gctgatcgtc
      901 acccatgtga ggccccatgg acccgtctat aagaccggtc gcatcaagcc cggcgatcgc
      961 ttgttgcgcg tcgataatgt ctcacttatt ggcaaaacgc tggcagaggc gcaacagatc
     1021 atcaagtgcg gcggtcatgt ttccgggtat accaacctga ccatcgagta cgatgtttcc
     1081 gtggtgcaga gcgttgagtt ctcgatggga ccgctgatca tcgagatcga gcggccgatg
     1141 aacgataagt tgggcctggt actttgcaac tatacgccgg cgatggccgc ttccggttcc
     1201 ggttcgagta cgccatccag tggggagaag atcgaggaat cgacgggcgt ctttatagcc
     1261 agcatcctgc ccgctagcat tgcagatcgt tgcggcgcct tatccgtcgg cgatcaggtg
     1321 ctctccatcg acgacacaat gatcgagcac accgccttca gtcccgacga ggtgatgacc
     1381 atattggaca ccagcacggg tcgcggctac acgcagatgc agatcatgcc cgctcacgcg
     1441 ttggcccgtc gcggacacac ggcattgggc agtcccaagt acagctttag caccctggag
     1501 tcccgcaaat cctcgacggc gggtcgccag cgtcagcgtt tcgcccgcaa gagttccctg
     1561 ccgctggaga atgcaggggt caacactccg ggatcctcgg tgggcatggt gggtctgggc
     1621 ctctgccgcg ccgagagctt tcccgttctc ctcgactgca gccacggagc gggcattatc
     1681 ctgggggaat ctccagcagg aggaggagca ggaggaggat ctgccggcgg aggagctgtg
     1741 gccattgccc agatcctcaa cgattcggtg gccgatcgca gtggctgcat tcaggcgggc
     1801 gatcgcattg tggccatcaa caagatgtac agcctggatg cgggggccat gaggcagctg
     1861 ctcgagggag gatcgggtcg cggaggagca ggaaacaact cgggaacgcc gccggccaat
     1921 tggctggagc tggagatcga gttcgatatg ccggatgccg tggtgcctgc cagtggtgtc
     1981 tttagtgtca agctgctgag ggccggcaaa tgtggattgg gactgagtgt gagtggctcc
     2041 agccatggcg gcctggtcat ttcggacgtc aagatgggca gtccggcgca tcgcagcggc
     2101 tctttgagat cgggcgacat cctgctggcc gtcgaccagc atccagtgca gcatttcaat
     2161 gtggacgcac tgctcaagga gcagcagaat ccctcatcct ccgcgtcctc cgcctcctcg
     2221 gatttcacca cgctcaccat caagcggatc gtcctgcccg acttcctgcc catgtccagt
     2281 cccatctaca gcaattgccc accgatggcc atgggaatgg gcggcatggg tgtctcgtcc
     2341 agcagcacgg atcacgatct gtatagcagc gcctatgtga cggcgggcaa gtacgccgac
     2401 tgcgtctccc tgaagtcgcg gactccgcag ccggactact tccgggtgcc cagcatggac
     2461 gacgccagtc tgcagtcggt gcagctgcgt tccggatcgg ggtgctcggg gaatggcggc
     2521 agtcgagggg tcaacgaggc aggcaacggc tggtccaccg ccggcgtcaa cagccgatcc
     2581 tttggggcag ccagcaacca actgcccaac acccagagcc tgaccaccga gctgcccgag
     2641 gaggaggacg aacaggagca gctgtatccc ggctacgagc tcaatcgcta tgccagtgtg
     2701 gactgcaccg ccctgccgcc gcccatggag aacaaggtct acggatcggc ggccagttcg
     2761 agcagcaaga gcagcgggag cagcctgcac cagatcatct tcacggtgcg tctggagccc
     2821 aaggggggac tgctgggcat cactctggct ggcagcgagg atatcaccaa gcccatcacg
     2881 atcagtggtc tcgtggaggg tggcattgcg cacaagaatg gccagatcca tgtgagtgac
     2941 cagctgctgg ccatcgacga gcactcggtg cagggcatgc ccctttcgca tgccaccagt
     3001 ctgctgcaga atctcggcga tctggtggac ctgaagatcc tgcggagtca cgatctggcc
     3061 aacggcagtc atctgccgca gacgcaggcc atttacgcga aggtccagcg gcgtccgcgg
     3121 agtccttcgg cgaatacgga ggccagcaag gagtcgggga atggaaatag caacggatgt
     3181 ggagctggca gtaatggcaa tggcggaaat ggaaagcccc gcgtcttcca tgtcaccctg
     3241 tacaaggaca aggtgtacga cgactatggc ttctcggttt ccgatggact ctacgagcgg
     3301 ggcgtcttca tcaacaggat tcgcagtggc gggccggcgg atatgtgcgg tctcctgaag
     3361 cccttcgatc gcattatgca ggttaacgaa atgaagacgc aggactttga ttgctgcctt
     3421 actgttccgc tgatcgccgc cgccggcgat aaaatcgaga tgatcatgca gcgcacagag
     3481 tgatcctcag tgtgcgcgat ccttatgtta aactagttgt acgctaagct aatcctaagt
     3541 gccattgcta gcccataata ttatatacga tatcccctcc gtattctgta ttctgtatgc
     3601 tgtactcctt accgaacgaa acgtaatcca cgaaacagaa agataaacac caaccttcaa
     3661 ggacaataag ctctctaaac aacagtctgc cataaccaaa aaatgtcctc tatttaatat
     3721 aaatctgcca taattttaca ttaattctac gctaaatttg tttcctagca aataaataat
     3781 cataccgaca gtttgtttca aactaaacaa tcaagaacta tgagtaattt cattgc