Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Septin 1 (Septin1), mRNA.


LOCUS       XM_017153810            1497 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017153810
VERSION     XM_017153810.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153810.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1497
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1497
                     /gene="Septin1"
                     /note="Septin 1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 6 Proteins"
                     /db_xref="GeneID:108065694"
     CDS             79..1167
                     /gene="Septin1"
                     /codon_start=1
                     /product="septin-1"
                     /protein_id="XP_017009299.1"
                     /db_xref="GeneID:108065694"
                     /translation="MADTKGFSSIETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGES
                     GLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPG
                     FGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRNIVDNRIHCCFYFISPFGHGLKP
                     LDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIKIYPLPDCDSDE
                     DEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDFIKLRT
                     MLITHMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKADRDRDSNSQVVANTLGEKD
                     RILQEKEAELRRMQEMLAQMQARMQAQQ"
     misc_feature    175..990
                     /gene="Septin1"
                     /note="Region: Septin; pfam00735"
                     /db_xref="CDD:395596"
     misc_feature    202..225
                     /gene="Septin1"
                     /note="G1 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    order(208..228,373..375,382..384,616..621,625..627,
                     793..798)
                     /gene="Septin1"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206649"
     misc_feature    298..324
                     /gene="Septin1"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206649"
     misc_feature    304..306
                     /gene="Septin1"
                     /note="G2 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    373..384
                     /gene="Septin1"
                     /note="G3 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    order(379..486,487..516)
                     /gene="Septin1"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206649"
     misc_feature    616..627
                     /gene="Septin1"
                     /note="G4 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    793..801
                     /gene="Septin1"
                     /note="G5 box; other site"
                     /db_xref="CDD:206649"
     polyA_site      1497
                     /gene="Septin1"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cttccacctc taataattaa tcgtattttg ttcgtcatta cgttgatttc ttcgttcgtt
       61 tcgtgttttt tttttaaaat ggccgataca aagggctttt ccagcatcga gactcccggc
      121 tatgtgggct tcgctaactt gcccaaccag gttcatcgca agtccgtgaa aaagggcttc
      181 gagttcacgc tgatggtggt gggcgaatcc ggactgggca agtccacgct ggtcaacagc
      241 ctcttcctca ccgatctcta tcccgagcgc atcattccgg atgccataga gaaacaaaag
      301 cagacggtga agctggaggc atcgacggtg gagatcgagg agcgcggcgt caagctgcga
      361 ctgacggtgg tggacacacc cggattcggc gatgccatcg acaactccaa cagctttggc
      421 gccatactcg agtacattga cgagcagtac gagcgcttcc tgcgcgacga gagtggcctc
      481 aacagacgca acattgtgga caatcgcatt cactgctgtt tctactttat atcgcccttt
      541 ggccatggcc taaagcccct cgacgtggag ttcatgaaga agctgcactc gaaggtcaac
      601 attgtgcccg tgatcgccaa ggccgattgc ctgacgaaga aggagatcct gcgcctcaag
      661 tgccgcatta tgcaggagat cgagagccac ggcatcaaga tctacccact gccagactgt
      721 gattccgacg aggacgagga ctacaaggag caggtgaagc aactgaagga agcagtgcct
      781 ttcgccgtct gcggcgccaa cactctgctc gaggtcaagg gcaagaaggt gcgcggccgc
      841 ctctatccgt ggggcgtggt cgaggtggag aatcccgatc actgcgactt catcaagctg
      901 cgcaccatgc tgatcaccca catgcaggac ctgcaggagg tgacgcagga ggtgcactac
      961 gagaactacc gctccgaccg gctggccaag ggcatcaagg gcaaggagaa cggcgtgaag
     1021 gccgatcggg accgggacag caactcgcag gtggtggcca atacactggg cgaaaaggat
     1081 cgcattctgc aggagaagga ggccgagctg cggcggatgc aggaaatgct cgctcaaatg
     1141 caggcgcgca tgcaggccca gcaatgagca ggctcgtata tatatactat atatacgcgc
     1201 tgagcggagg cggcaatcta tacatagtta tacacacaac tcgtatatat acatatacac
     1261 aacatatatt ttgtacgcag attttggttg cgatcgcgct ttaattctac tctcaattgt
     1321 gaaacgacgg gcgctaatga ttctgtatta atttcgcatt ctccatatac atatatatat
     1381 acaaataatc gtaggatcta ggtatacaca ccatatacat ttatacacac acaaccaaca
     1441 cctgccacgt aggcaaaacg tctgcaatgc aattgcgctc catcaaagaa agaaaaa