Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153810 1497 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017153810 VERSION XM_017153810.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153810.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1497 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1497 /gene="Septin1" /note="Septin 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108065694" CDS 79..1167 /gene="Septin1" /codon_start=1 /product="septin-1" /protein_id="XP_017009299.1" /db_xref="GeneID:108065694" /translation="MADTKGFSSIETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGES GLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPG FGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRNIVDNRIHCCFYFISPFGHGLKP LDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIKIYPLPDCDSDE DEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDFIKLRT MLITHMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKADRDRDSNSQVVANTLGEKD RILQEKEAELRRMQEMLAQMQARMQAQQ" misc_feature 175..990 /gene="Septin1" /note="Region: Septin; pfam00735" /db_xref="CDD:395596" misc_feature 202..225 /gene="Septin1" /note="G1 box; other site" /db_xref="CDD:206649" misc_feature order(208..228,373..375,382..384,616..621,625..627, 793..798) /gene="Septin1" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206649" misc_feature 298..324 /gene="Septin1" /note="Switch I region; other site" /db_xref="CDD:206649" misc_feature 304..306 /gene="Septin1" /note="G2 box; other site" /db_xref="CDD:206649" misc_feature 373..384 /gene="Septin1" /note="G3 box; other site" /db_xref="CDD:206649" misc_feature order(379..486,487..516) /gene="Septin1" /note="Switch II region; other site" /db_xref="CDD:206649" misc_feature 616..627 /gene="Septin1" /note="G4 box; other site" /db_xref="CDD:206649" misc_feature 793..801 /gene="Septin1" /note="G5 box; other site" /db_xref="CDD:206649" polyA_site 1497 /gene="Septin1" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cttccacctc taataattaa tcgtattttg ttcgtcatta cgttgatttc ttcgttcgtt 61 tcgtgttttt tttttaaaat ggccgataca aagggctttt ccagcatcga gactcccggc 121 tatgtgggct tcgctaactt gcccaaccag gttcatcgca agtccgtgaa aaagggcttc 181 gagttcacgc tgatggtggt gggcgaatcc ggactgggca agtccacgct ggtcaacagc 241 ctcttcctca ccgatctcta tcccgagcgc atcattccgg atgccataga gaaacaaaag 301 cagacggtga agctggaggc atcgacggtg gagatcgagg agcgcggcgt caagctgcga 361 ctgacggtgg tggacacacc cggattcggc gatgccatcg acaactccaa cagctttggc 421 gccatactcg agtacattga cgagcagtac gagcgcttcc tgcgcgacga gagtggcctc 481 aacagacgca acattgtgga caatcgcatt cactgctgtt tctactttat atcgcccttt 541 ggccatggcc taaagcccct cgacgtggag ttcatgaaga agctgcactc gaaggtcaac 601 attgtgcccg tgatcgccaa ggccgattgc ctgacgaaga aggagatcct gcgcctcaag 661 tgccgcatta tgcaggagat cgagagccac ggcatcaaga tctacccact gccagactgt 721 gattccgacg aggacgagga ctacaaggag caggtgaagc aactgaagga agcagtgcct 781 ttcgccgtct gcggcgccaa cactctgctc gaggtcaagg gcaagaaggt gcgcggccgc 841 ctctatccgt ggggcgtggt cgaggtggag aatcccgatc actgcgactt catcaagctg 901 cgcaccatgc tgatcaccca catgcaggac ctgcaggagg tgacgcagga ggtgcactac 961 gagaactacc gctccgaccg gctggccaag ggcatcaagg gcaaggagaa cggcgtgaag 1021 gccgatcggg accgggacag caactcgcag gtggtggcca atacactggg cgaaaaggat 1081 cgcattctgc aggagaagga ggccgagctg cggcggatgc aggaaatgct cgctcaaatg 1141 caggcgcgca tgcaggccca gcaatgagca ggctcgtata tatatactat atatacgcgc 1201 tgagcggagg cggcaatcta tacatagtta tacacacaac tcgtatatat acatatacac 1261 aacatatatt ttgtacgcag attttggttg cgatcgcgct ttaattctac tctcaattgt 1321 gaaacgacgg gcgctaatga ttctgtatta atttcgcatt ctccatatac atatatatat 1381 acaaataatc gtaggatcta ggtatacaca ccatatacat ttatacacac acaaccaaca 1441 cctgccacgt aggcaaaacg tctgcaatgc aattgcgctc catcaaagaa agaaaaa