Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153807 907 bp mRNA linear INV 09-DEC-2024 protein 17 (LOC108065692), mRNA. ACCESSION XM_017153807 VERSION XM_017153807.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153807.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..907 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..907 /gene="LOC108065692" /note="thioredoxin domain-containing protein 17; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065692" CDS 479..877 /gene="LOC108065692" /codon_start=1 /product="thioredoxin domain-containing protein 17" /protein_id="XP_017009296.1" /db_xref="GeneID:108065692" /translation="MPEYVPARGFKEMENLLKLYDTKSCPIYIYFYGEKDKQGRSWCP DCVAAEDTIMTAFRTNAPADCIILVVDVGNREFWMAKDNAFRSPPYSVDGIPALLHWK GPERLDGDQLLKKNLLELFFEETDTRKSTV" misc_feature 494..850 /gene="LOC108065692" /note="Eukaryotic protein of unknown function (DUF953); Region: DUF953; pfam06110" /db_xref="CDD:399247" misc_feature order(605..607,614..616) /gene="LOC108065692" /note="catalytic residues [active]" /db_xref="CDD:239250" polyA_site 907 /gene="LOC108065692" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccaacaaccc aagctatttg tgccacaaaa taagccaaaa ttttcgattt gcaaaatgta 61 tttgattaga taatacgcgt gtgaagcttt cgataaaacg gtcaacagtg gttaacagta 121 ttcaccacgg tgcgcttaac agcacgcgcc gccggacgtg gtgagttcgc tggagtgcaa 181 gtgtggtgag caccgccatt gctggagagc cgcaaacaaa aacaaaaaca gaaacagaaa 241 gcacactgaa aacagcgatt tgaaacgcct ctaattaccc gataaacatc ccgatggccg 301 ataagcgacg gctaagaaac ccgtaagacc cagcgataag atccagataa gattgggatt 361 ggaattggaa tcggaatcgc cacgaatcac cacaaatcac catcgcccgg cactcaattc 421 acttgcacat cggggcatta ggactcaaaa attggattac cataatatca ccatcataat 481 gcccgaatac gtaccggcac gcggcttcaa ggagatggag aatctgctca agctctacga 541 caccaagagc tgccccatct acatctactt ctacggcgag aaggacaagc agggacgcag 601 ctggtgtccg gactgcgtgg cggccgagga tacgattatg accgcctttc gcacgaacgc 661 ccctgcggac tgcattatcc tggtggtgga cgtcggcaat cgggagttct ggatggccaa 721 ggacaacgcg ttccgcagtc cgccctactc ggtggacggg attccggccc tgctccactg 781 gaaggggccg gagcgtctgg acggcgatca gctgctgaag aagaatctcc tggagctctt 841 cttcgaggag accgatacgc gcaagagcac tgtgtagtca ctcaataaaa tgcgatttga 901 gctcgaa