Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153794 1579 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_017153794 VERSION XM_017153794.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153794.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1579 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1579 /gene="Ugalt" /note="UDP-galactose transporter; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108065684" CDS 233..1297 /gene="Ugalt" /codon_start=1 /product="UDP-N-acetylglucosamine transporter isoform X2" /protein_id="XP_017009283.2" /db_xref="GeneID:108065684" /translation="MNIHMNANTLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSST AVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNN LLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLA QTVGPSSGPAAGASATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEI SVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAV VVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARS TPKSNMQGPGGDEEKLLPRV" misc_feature 248..1216 /gene="Ugalt" /note="Nucleotide-sugar transporter; Region: Nuc_sug_transp; pfam04142" /db_xref="CDD:398009" polyA_site 1579 /gene="Ugalt" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgtttacg tgtcgcccgg tgcggtgtgg agtcgtcttc ttttctgttt cagctcttct 61 ggccaaccaa tcgtccaacc gccgaacgga acggcccgcc gcagactgat cttggccaga 121 aactgagtcc acaccacttt gtgcacgaaa acaaactgcg gcatttgttt gccttcggtt 181 tctattgttg cgttggggca aagtaaaaca agggagtttg aagcggagca gcatgaatat 241 acacatgaac gccaataccc tgaagtacat cagcctgctg acgctgaccc tgcagaatgc 301 gatcctgggc ctcagcatgc ggtacgcccg cacccggcca ggcgacatct tcctcagctc 361 cacggccgtg ctaatggccg agtttgccaa gctgatcacg tgcctgttcc tggtcttcaa 421 cgaggagggc aaggatgccc agaagttcgt ccgctcgctg cacaagacca tcatcgccaa 481 tcccatggac acgctgaagg tgtgcgtgcc ctcgctggtc tacatcgtcc agaacaacct 541 gctgtatgtg tccgcctcgc atctggatgc ggccacctac caggtgacgt accagctgaa 601 gatcctcacc accgccatgt ttgcggtggt gatcctgcgc cgcaagctgc tcaacaccca 661 gtggggtgct ctgctgctcc tggtgatggg cattgtcctg gtgcagttgg cccaaacggt 721 gggtccatcg agtggtccgg ccgctggagc ttcggccacg gccgcctcct cgggaggagc 781 acccgaacag aacaggatgc tgggtctgtg ggccgccctg ggcgcctgtt tcctctccgg 841 attcgcgggc atctacttcg agaagatcct caagggcgcc gagatctccg tgtggatgcg 901 gaatgtgcag ctgagtctgc tgagcattcc cttcggcctg ctcacctgct tcgtgaacga 961 cggcagccgg atcttcgacc agggattctt ccatggctac gacgtgttcg tctggtatct 1021 ggtgctgctg caggccggcg gtggcctgat cgtggccgtg gtggtcaagt atgcggacaa 1081 catactgaag ggcttcgcca cctcgctggc catcatcatc tcgtgcgtgg cctccatcta 1141 catctttgac ttcaatctca cgctgcagtt cagcttcgga gccggcctgg tcatcgcctc 1201 gatctttctg tatggctatg atcctgccag atccacgccc aagtcgaata tgcagggtcc 1261 tggcggcgac gaggagaaac tgctgccacg cgtctagctc tggaggaatc tggacctgtc 1321 aacagtattt gtccacaatt cggcggccgt tcgatgactg catccaatgt tcttgatatt 1381 ccccacgttg tgtgtgtata tatgttaggg tggatattaa tgtctggaca attcgtagca 1441 ctttcccctg ggaaacgata gttataatgt aagggaaacg agaaggataa gaatacttaa 1501 ttatttatgt aatttaaata tacttagggt attcactagc taaactgaag tatagatatt 1561 aaaatgattc acattttta