Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii UDP-galactose transporter (Ugalt),


LOCUS       XM_017153794            1579 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_017153794
VERSION     XM_017153794.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153794.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1579
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1579
                     /gene="Ugalt"
                     /note="UDP-galactose transporter; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108065684"
     CDS             233..1297
                     /gene="Ugalt"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine transporter isoform X2"
                     /protein_id="XP_017009283.2"
                     /db_xref="GeneID:108065684"
                     /translation="MNIHMNANTLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSST
                     AVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNN
                     LLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLA
                     QTVGPSSGPAAGASATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEI
                     SVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFHGYDVFVWYLVLLQAGGGLIVAV
                     VVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARS
                     TPKSNMQGPGGDEEKLLPRV"
     misc_feature    248..1216
                     /gene="Ugalt"
                     /note="Nucleotide-sugar transporter; Region:
                     Nuc_sug_transp; pfam04142"
                     /db_xref="CDD:398009"
     polyA_site      1579
                     /gene="Ugalt"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgtttacg tgtcgcccgg tgcggtgtgg agtcgtcttc ttttctgttt cagctcttct
       61 ggccaaccaa tcgtccaacc gccgaacgga acggcccgcc gcagactgat cttggccaga
      121 aactgagtcc acaccacttt gtgcacgaaa acaaactgcg gcatttgttt gccttcggtt
      181 tctattgttg cgttggggca aagtaaaaca agggagtttg aagcggagca gcatgaatat
      241 acacatgaac gccaataccc tgaagtacat cagcctgctg acgctgaccc tgcagaatgc
      301 gatcctgggc ctcagcatgc ggtacgcccg cacccggcca ggcgacatct tcctcagctc
      361 cacggccgtg ctaatggccg agtttgccaa gctgatcacg tgcctgttcc tggtcttcaa
      421 cgaggagggc aaggatgccc agaagttcgt ccgctcgctg cacaagacca tcatcgccaa
      481 tcccatggac acgctgaagg tgtgcgtgcc ctcgctggtc tacatcgtcc agaacaacct
      541 gctgtatgtg tccgcctcgc atctggatgc ggccacctac caggtgacgt accagctgaa
      601 gatcctcacc accgccatgt ttgcggtggt gatcctgcgc cgcaagctgc tcaacaccca
      661 gtggggtgct ctgctgctcc tggtgatggg cattgtcctg gtgcagttgg cccaaacggt
      721 gggtccatcg agtggtccgg ccgctggagc ttcggccacg gccgcctcct cgggaggagc
      781 acccgaacag aacaggatgc tgggtctgtg ggccgccctg ggcgcctgtt tcctctccgg
      841 attcgcgggc atctacttcg agaagatcct caagggcgcc gagatctccg tgtggatgcg
      901 gaatgtgcag ctgagtctgc tgagcattcc cttcggcctg ctcacctgct tcgtgaacga
      961 cggcagccgg atcttcgacc agggattctt ccatggctac gacgtgttcg tctggtatct
     1021 ggtgctgctg caggccggcg gtggcctgat cgtggccgtg gtggtcaagt atgcggacaa
     1081 catactgaag ggcttcgcca cctcgctggc catcatcatc tcgtgcgtgg cctccatcta
     1141 catctttgac ttcaatctca cgctgcagtt cagcttcgga gccggcctgg tcatcgcctc
     1201 gatctttctg tatggctatg atcctgccag atccacgccc aagtcgaata tgcagggtcc
     1261 tggcggcgac gaggagaaac tgctgccacg cgtctagctc tggaggaatc tggacctgtc
     1321 aacagtattt gtccacaatt cggcggccgt tcgatgactg catccaatgt tcttgatatt
     1381 ccccacgttg tgtgtgtata tatgttaggg tggatattaa tgtctggaca attcgtagca
     1441 ctttcccctg ggaaacgata gttataatgt aagggaaacg agaaggataa gaatacttaa
     1501 ttatttatgt aatttaaata tacttagggt attcactagc taaactgaag tatagatatt
     1561 aaaatgattc acattttta