Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017153745            1100 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065660), transcript variant X2, mRNA.
ACCESSION   XM_017153745
VERSION     XM_017153745.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153745.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1100
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1100
                     /gene="LOC108065660"
                     /note="uncharacterized LOC108065660; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108065660"
     CDS             207..1061
                     /gene="LOC108065660"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_017009234.1"
                     /db_xref="GeneID:108065660"
                     /translation="MGMRHLTAATKMGVSPVGVLGFMLLQLVISVRGHGRLMDPPARN
                     AMWRFGYPNPVNYNDNELFCGGYAVQWEKNSGRCGVCGDAYHVKSPRPHEAGGEYAKG
                     IISRYYTSGQEIDVEVELTANHYGRFEMFLCPNNNPRQEATQACFDRFPLLISGSREH
                     RYLIPRDAKKKDIFRYRVRLPPYVTCTQCVLQWTYYTANMWGTCANGTEAVGCGKAET
                     FRNCADIAIISNTGGGVPPIFVNNKSPYLLYYRDYRAPAENNIFPLIVRNATRHARKR
                     SKAKPLTR"
     misc_feature    306..881
                     /gene="LOC108065660"
                     /note="Lytic polysaccharide mono-oxygenase,
                     cellulose-degrading; Region: LPMO_10; pfam03067"
                     /db_xref="CDD:460793"
ORIGIN      
        1 agaaatttcc aattctctgg aattttgtga actcaaatta acatttcgat acctcgacgc
       61 attttttttt cgagttttcc cttttgtatt ttgtgcattt tgtgtgtgcg tgaacaattt
      121 taagtgccaa caatttttgc ggagtactgc gtaaattaca cgaaaatatt caggcatctg
      181 ggaatcctga aatctggaat tctggaatgg ggatgcgaca cttgacagcc gccacaaaaa
      241 tgggcgtttc gccagtgggt gtgctgggct ttatgctcct ccaactggtg atttcggtgc
      301 ggggacatgg tcggctgatg gatccaccgg ctaggaatgc gatgtggcga tttggctatc
      361 cgaatcccgt aaattacaat gataacgagc tcttttgcgg cggctatgcg gttcagtggg
      421 agaagaacag tggtcgctgt ggtgtctgcg gcgatgccta tcacgtcaag tcgccgcggc
      481 cccacgaagc tggcggggaa tacgccaagg gcatcatctc gcgctactat acctctggcc
      541 aggagatcga cgtggaggtg gaactgacgg ccaatcatta tggccgtttc gagatgttcc
      601 tctgcccgaa caacaatccg cgacaggagg ccacccaggc ctgcttcgat cggttcccgc
      661 tgctgatttc gggcagtcgg gagcatcgat acctcattcc gcgcgatgcc aagaagaagg
      721 atatattccg ctatcgggtg cgactgccgc cctatgtcac ctgcacgcag tgcgtcctgc
      781 agtggaccta ctataccgcc aatatgtggg gcacctgcgc caatggaacc gaggccgtgg
      841 gatgcggcaa ggcagaaacc ttccggaatt gtgcagatat agcgattatc tcaaacaccg
      901 gtggtggtgt tccgccgatt ttcgtgaaca ataagtcacc atatctgctc tattatcgcg
      961 actatcgggc accggcggag aacaacatct ttccccttat tgtgcgcaat gccacgcggc
     1021 atgcacgcaa gcgcagcaag gctaaaccgc ttacccgcta atcagcttac ccgaatccgc
     1081 ctataaaccg cttacccgct