Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017153740 1207 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017153740 VERSION XM_017153740.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; corrected model. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017153740.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-36 JARPSC010000001.1 21724871-21724906 37-293 JARPSC010000001.1 21724909-21725165 294-579 JARPSC010000001.1 21725228-21725513 580-1207 JARPSC010000001.1 21726219-21726846 FEATURES Location/Qualifiers source 1..1207 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1207 /gene="LOC108065657" /note="trypsin; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108065657" CDS 16..969 /gene="LOC108065657" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: trypsin" /protein_id="XP_017009229.3" /db_xref="GeneID:108065657" /translation="MEHQWMCVLMLLILAAYPGNSIVQIHPPTSTASGFVILPKIVGG YTVTIDQVPFQVSVRRRKIHEQHYGMGHVCGGAIISQRVVCSAAHCYAINNSVPLQYR DPELYVVVAGSSTIDRTDRFTQEYLVQRIIGHERYNRSTLENDIALLFLNGFIPWQTQ VARAIPLTIEAPQEGTTCLIHGWGKVTPKDKSGSLQQAPVPILNKELCQVIYKLPASQ MCAGFLQGGIDACQGDSGGPLICDGQLAGIISWGVGCADPGYPGVYTNVSHFIDWIRA ANTSLDYAEYRQMTPENLASRRSISFQFLDIGLLGLIITLL" misc_feature 136..840 /gene="LOC108065657" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 136..138 /gene="LOC108065657" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(280..282,448..450,718..720) /gene="LOC108065657" /note="active site" /db_xref="CDD:238113" misc_feature order(700..702,763..765,769..771) /gene="LOC108065657" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" ORIGIN 1 atttaaccgc atcccatgga acaccaatgg atgtgcgtgc tgatgttgct gattttggcg 61 gcctatcccg gaaacagcat cgtccagatc catccaccga cgtccacggc ctcgggcttt 121 gtgatcctgc ctaaaattgt gggcggctac acggtgacca ttgaccaggt gcccttccag 181 gtgtccgtgc gtaggcgaaa aatccacgag cagcactacg gaatgggcca tgtgtgcggc 241 ggagcgatta tctcccagcg ggttgtctgc tcggcggccc actgctacgc cataaacaat 301 tccgtaccac tgcagtatcg ggatccggaa ctatatgtcg tcgtggccgg cagcagtacc 361 atcgatcgga cggaccgctt tacgcaggag tatctcgtgc agcggatcat cggacacgag 421 cggtacaaca ggagcacgct ggagaacgac atcgccctgc tcttcctcaa cggattcata 481 ccgtggcaaa cgcaagtggc gcgggcgata ccgttgacca tcgaagctcc ccaagagggc 541 accacctgtc tcattcacgg ctggggcaag gtcacgccga aggacaaatc gggttcgctg 601 cagcaggccc ctgtaccgat actgaacaag gagctctgcc aggtgatcta caagctgccc 661 gcctcccaga tgtgcgccgg attcctgcag ggcggtatag atgcctgcca gggtgactcc 721 ggcggaccgc tgatctgcga cggacaactg gccgggataa tatcgtgggg cgtgggctgt 781 gcggatcccg gctatccggg tgtttatacg aatgtctcgc actttattga ctggatccgg 841 gcggccaaca cttcattgga ttacgccgag taccgccaaa tgacgccgga gaatcttgct 901 agccgtcgat cgatatcgtt tcagttcttg gatattggcc ttctggggct tatcatcaca 961 cttctttgac gatcggacag cgcaataaat cgctttctct tgtctgttct acaactgatt 1021 tatctaatcg tgccgagaag gcacccactt gtagattgtc caatagttga cggtgatcga 1081 cggcattgat gacatcagag gaggaggggc ccactgaggg taacaaggag tctcttggta 1141 caggaaatat tctaaaaatt ttaagaggaa taacattaaa aataaaacac gtcacataca 1201 aaccgca