Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii trypsin (LOC108065657), mRNA.


LOCUS       XM_017153740            1207 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017153740
VERSION     XM_017153740.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017153740.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-36                JARPSC010000001.1  21724871-21724906
            37-293              JARPSC010000001.1  21724909-21725165
            294-579             JARPSC010000001.1  21725228-21725513
            580-1207            JARPSC010000001.1  21726219-21726846
FEATURES             Location/Qualifiers
     source          1..1207
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1207
                     /gene="LOC108065657"
                     /note="trypsin; The sequence of the model RefSeq
                     transcript was modified relative to its source genomic
                     sequence to represent the inferred CDS: deleted 2 bases in
                     1 codon; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108065657"
     CDS             16..969
                     /gene="LOC108065657"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 2 bases in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: trypsin"
                     /protein_id="XP_017009229.3"
                     /db_xref="GeneID:108065657"
                     /translation="MEHQWMCVLMLLILAAYPGNSIVQIHPPTSTASGFVILPKIVGG
                     YTVTIDQVPFQVSVRRRKIHEQHYGMGHVCGGAIISQRVVCSAAHCYAINNSVPLQYR
                     DPELYVVVAGSSTIDRTDRFTQEYLVQRIIGHERYNRSTLENDIALLFLNGFIPWQTQ
                     VARAIPLTIEAPQEGTTCLIHGWGKVTPKDKSGSLQQAPVPILNKELCQVIYKLPASQ
                     MCAGFLQGGIDACQGDSGGPLICDGQLAGIISWGVGCADPGYPGVYTNVSHFIDWIRA
                     ANTSLDYAEYRQMTPENLASRRSISFQFLDIGLLGLIITLL"
     misc_feature    136..840
                     /gene="LOC108065657"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    136..138
                     /gene="LOC108065657"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(280..282,448..450,718..720)
                     /gene="LOC108065657"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(700..702,763..765,769..771)
                     /gene="LOC108065657"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 atttaaccgc atcccatgga acaccaatgg atgtgcgtgc tgatgttgct gattttggcg
       61 gcctatcccg gaaacagcat cgtccagatc catccaccga cgtccacggc ctcgggcttt
      121 gtgatcctgc ctaaaattgt gggcggctac acggtgacca ttgaccaggt gcccttccag
      181 gtgtccgtgc gtaggcgaaa aatccacgag cagcactacg gaatgggcca tgtgtgcggc
      241 ggagcgatta tctcccagcg ggttgtctgc tcggcggccc actgctacgc cataaacaat
      301 tccgtaccac tgcagtatcg ggatccggaa ctatatgtcg tcgtggccgg cagcagtacc
      361 atcgatcgga cggaccgctt tacgcaggag tatctcgtgc agcggatcat cggacacgag
      421 cggtacaaca ggagcacgct ggagaacgac atcgccctgc tcttcctcaa cggattcata
      481 ccgtggcaaa cgcaagtggc gcgggcgata ccgttgacca tcgaagctcc ccaagagggc
      541 accacctgtc tcattcacgg ctggggcaag gtcacgccga aggacaaatc gggttcgctg
      601 cagcaggccc ctgtaccgat actgaacaag gagctctgcc aggtgatcta caagctgccc
      661 gcctcccaga tgtgcgccgg attcctgcag ggcggtatag atgcctgcca gggtgactcc
      721 ggcggaccgc tgatctgcga cggacaactg gccgggataa tatcgtgggg cgtgggctgt
      781 gcggatcccg gctatccggg tgtttatacg aatgtctcgc actttattga ctggatccgg
      841 gcggccaaca cttcattgga ttacgccgag taccgccaaa tgacgccgga gaatcttgct
      901 agccgtcgat cgatatcgtt tcagttcttg gatattggcc ttctggggct tatcatcaca
      961 cttctttgac gatcggacag cgcaataaat cgctttctct tgtctgttct acaactgatt
     1021 tatctaatcg tgccgagaag gcacccactt gtagattgtc caatagttga cggtgatcga
     1081 cggcattgat gacatcagag gaggaggggc ccactgaggg taacaaggag tctcttggta
     1141 caggaaatat tctaaaaatt ttaagaggaa taacattaaa aataaaacac gtcacataca
     1201 aaccgca